KEGG   Anas platyrhynchos (mallard): 101798829Help
Entry
101798829         CDS       T02816                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00511  Other glycan degradation
apla00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101798829 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101798829 (NEU2)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101798829 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 101798829
NCBI-ProteinID: XP_012964176
LinkDB All DBs
Position
Un
AA seq 434 aa AA seqDB search
MRDYDCVRSPIGSKGKRWLPEIVKHMSPSKAKCTCNGESTSLLEDFENILRSNSVMASIP
VLKQETLFRNSTWSYRIPALLYLPRFSIILAFAEEREDVVDEHAKLIAMRRGMYDPTTHH
VQWSSMETIVSAQLKDHRSMNPCPVYDEVSGKLILFFIAVPGKISEQHQLRTKTNLVRLC
YITSMDQGRTWSTVQDITEGTISSEYKNWATFAVGPGHGLQLLNEARSLVIPAYAYRILD
PKQHPTPHAFCFISSDHGTTWEMGNFVGKESAVECQVAEVHTCGRRVLYCNARSSKGARI
QAVSYNHGVDFEGGQRVEMLVEPPFGCHGSVTAFPPPRDARCQDSWLLYTHPTDPKGRRD
LGIYLNKTPLNPEQWTKPSILFKGLCAYSDLQYMGVGPDGSPLFSCLFEYGTQQQCEEII
FVMFTLKQAFPSEC
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacgactgtgtgaggagccccattggcagcaaagggaagagatggctgcca
gagatagttaagcacatgtccccgtccaaagcaaagtgcacatgcaatggtgaaagtaca
tccctgcttgaagattttgagaacatcttgagaagtaacagcgtgatggcttcaattcct
gtcctgaagcaagagacgttgttccggaacagtacatggagctaccgaattccagccctg
ctctacctgccgcgtttcagcatcatcctggcatttgctgaagaacgagaggatgtggta
gatgaacatgccaagctgatagcaatgcgcagaggcatgtatgacccaaccacgcaccat
gttcagtggagtagcatggagaccattgtcagtgcacagctgaaagatcaccgctctatg
aatccctgtcctgtttatgacgaggtctcagggaaactgatcctgttcttcatagccgtc
ccaggaaagatctctgagcagcaccagctcaggacgaagaccaacctggtgcgtctctgc
tacatcactagcatggaccaaggacgcacctggagcactgtccaggatatcaccgagggt
accattagctccgagtacaagaactgggccaccttcgcagtggggccaggccacggatta
cagctgctcaatgaggcccggagccttgtgattcctgcctatgcctatcgtatccttgac
cctaagcagcaccccacccctcacgccttctgcttcatcagctctgaccatgggacgaca
tgggagatggggaactttgtggggaaggagagtgcagtggagtgccaggtagctgaggta
cacacctgtggcaggagggtgctctactgcaacgcaaggagcagcaagggagcgagaatc
caggccgtcagctacaaccacggggtggattttgagggaggccaacgggttgaaatgctt
gtagagcctccctttggatgtcatggaagtgttactgccttcccacctccccgtgatgcc
aggtgccaagatagttggttgctctacactcatcctacagacccaaagggtcgaagagat
ttaggaatttacctcaataaaacccctttaaacccagaacagtggacaaaaccaagcatc
ctcttcaagggtttatgtgcttattcagatctgcagtacatgggggttgggccagatggc
tcacccttgttctcctgcctttttgaatatgggactcaacagcaatgtgaagagataata
tttgtaatgttcactctgaagcaagccttcccatctgagtgctga

DBGET integrated database retrieval system