KEGG   Anas platyrhynchos (mallard): 101800928Help
Entry
101800928         CDS       T02816                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101800928 (F13A1)
Cell adhesion molecules and their ligands [BR:apla04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101800928 (F13A1)
   VLA-9
     101800928 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 736 aa AA seqDB search
MSEPTSTDKEKKKPPLNGRRALPSNNSNAEENEVPEMDAFGLIPRGFNPKDYLCVVDIHM
FKEPYEINKQQHHTDKYYNPKLIVRRGQPFQIQIDFNRPYKPETDQFWLEYLIGRYPQPN
KGTYIPILVGDVLKPGEWGAKIIHKENNSIRLSIMSSATCIVGKFRLYVAIWTPFGIIRT
HRNSATDTYILFNPWCQQDAVYLDDEKEREEYVLNDVGIVFHGDIDEIKLRSWSYGQFEE
NILDACLFLMDKAELELSGRGNPIKICRVASAVINSRDDNGVIAGSWDNTYTYGVAPSAW
TGSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLQLDF
FLDDEGQVDAKLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQAVDGTPQETSDGMYRCGPA
SVQAIKHGHVCFQFDAPFVFAEVNSDVVYSRREKNGAQIIEKIDTTHIGKLIVTKGVGTD
EMVEITEEYKFQEGSEEERLALETAVMYGVKKQSTQDDMYQPQKDVEMDFQVQKAVLGSD
FKVTITFRNKSRNSYTATTYLSGNIVFYTGVTKNEFKKHSFTVKLEPLMSSAFDVIITSS
EYLSDLLDQASFHFFVTARINETGKILAAQKATVLEIPSLRIKTQGEMVADKEMSVIVEF
TNPLKKTLEDVTLRLEGPGVLKTMKKEFRQIPSNSTLIWEVKCIPKRPGLRKLIASLNCD
ALRHVYGELSIQIQKP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccaacgagcaccgacaaagagaagaaaaaacctccattgaatgggagaaga
gccctcccatcaaacaactccaatgctgaagaaaatgaggtccctgaaatggatgctttt
ggattgatacctagaggatttaatccaaaagattacctgtgtgttgtggacattcatatg
ttcaaggaaccctatgagattaacaagcagcagcaccatactgacaagtactacaaccct
aaactgatagtgcgtcgagggcagcctttccaaatccagatcgacttcaaccgaccctac
aagccagagacagaccaattctggctggagtatttgataggtcgctacccacagccaaac
aaaggcacctacatcccgatccttgtaggtgatgttctgaagcctggggagtggggagcc
aagattatccacaaggaaaacaattcaattcgcctgtccatcatgtcctctgccacctgc
attgttgggaaatttcgcctgtatgttgctatctggactccttttggcatcatccggacg
catagaaactcggcaactgacacttacatactattcaacccgtggtgccaacaggatgcc
gtgtatctggatgacgagaaggaaagggaagaatatgtcctgaatgatgttggtattgtt
ttccatggagacattgacgaaataaaattaagaagctggagttacggtcagtttgaagaa
aacattctggatgcgtgccttttcctgatggacaaggcagaactggaactgtctgggcgt
ggaaacccaatcaaaatctgccgtgttgcttctgcagtgatcaattccagggatgataat
ggtgttattgctggatcctgggacaatacctacacttacggggttgcaccttcagcctgg
acaggaagtgtggacatcctcttggaatattacagttctaagcagccagtgcgatatggc
caatgctgggtctttgctggtgtcttcaacacatttctgaggtgcttggggatacctgca
agactcattaccaactattcttctgcccatgacaacaatgcaaatttacagttggacttc
tttctggatgacgaagggcaggtggatgccaaattgacaaaagactccatctggaactat
cattgctggaatgaagcttggatgaccagacctgatcttcctgttggttttggaggatgg
caggctgttgatgggacaccccaagaaaccagtgatggtatgtacagatgtggcccagct
tcagttcaagccattaaacatggtcacgtttgcttccaatttgatgctccttttgtcttt
gctgaggtgaatagtgatgttgtttactcaagaagggaaaaaaatggagcccaaattata
gaaaaaattgacacgacccatattgggaagttgattgtgaccaaaggagtcgggactgat
gaaatggtagagattactgaggagtacaagttccaagaaggttcagaggaggaaagactg
gctctggagactgctgttatgtatggtgttaaaaagcaaagtacccaagatgacatgtat
cagccacaaaaggatgttgagatggatttccaagtgcaaaaggcagtccttggcagtgac
tttaaagtcactataacgttcaggaacaagagccgcaactcctacactgctactacatac
ctttcaggcaacatagtgttttatacaggagtcacaaagaatgagttcaagaagcactct
ttcactgtgaaactggaaccccttatgtctagtgctttcgatgttatcatcacatcaagc
gagtacctgagtgatctgctggaccaagcctcctttcatttctttgtgacagcacggatc
aatgaaacagggaagatcctggccgcccagaaggcaacggtcctcgaaattccttccctg
cggatcaagactcaaggtgagatggtagctgataaagaaatgtctgtgattgtggagttc
accaatcctctgaaaaaaaccctggaggacgtcacgctccgcctcgagggacctggagtg
ctgaagacaatgaaaaaggagttcaggcaaatcccatcgaactctaccttgatctgggaa
gtaaaatgcatcccaaaacggccaggtttacgaaagctgattgcaagcctgaattgtgat
gctttgaggcatgtgtatggtgagctgagcatccagattcagaaaccatga

DBGET integrated database retrieval system