KEGG   Anas platyrhynchos (mallard): 101803303Help
Entry
101803303         CDS       T02816                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:apla00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101803303 (SOD1)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101803303 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101803303
NCBI-ProteinID: XP_012953313
LinkDB All DBs
Position
Un
AA seq 212 aa AA seqDB search
MAFDKGKFKVLQLGRNNPRHHQNMLENVLAEKDLGVLVDTKLNLVLVAELSGVFTALDCL
GSLTWHEAPCCGCFSSYSPLLLQGNGPVKVTGRISGLSDGDHGFHVHEFGDNTNGCTSAG
AHFNPEGKKHGGPKDAERHVGDLGNVTAKGGVADVEIEDSVISLTGPHCIIGRTMVVHAK
SDDLGKGGDNESTLTGNAGPRLACGVIGIAKC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgacaaggggaagttcaaggtcctacagctggggaggaacaaccccaggcac
caccagaacatgttggagaatgtcttggcagaaaaggacctgggggttctggtggacacc
aagttgaaccttgtgttggtagctgaacttagtggagtttttactgctttagattgtcta
ggaagcctcacctggcatgaggccccttgctgtggttgtttcagcagctatagtcccctt
ctcttacagggtaacggaccagtaaaagttactggaagaatcagtggcttgtctgatgga
gatcatggcttccatgtccacgaatttggggacaacacaaatggatgtaccagtgcaggt
gctcacttcaatcctgaaggcaagaagcatggtggaccaaaggatgcagagaggcacgtg
ggcgacctcggcaacgtgactgctaaaggaggagtagcagatgtggaaatagaagattcc
gtcatctctctgactggaccacactgcatcattgggcgcaccatggtggtccatgcaaaa
agcgacgacctgggcaaagggggagacaacgagagcacgctaaccgggaatgccgggcct
cgcctggcctgtggtgtcatcggaatagccaagtgctga

DBGET integrated database retrieval system