KEGG   Acanthaster planci (crown-of-thorns starfish): 110975028Help
Entry
110975028         CDS       T05078                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B-B-like isoform X1
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aplc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    110975028
Enzymes [BR:aplc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110975028
Chromosome [BR:aplc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110975028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 859 aa AA seqDB search
MMGIDGTGPGWPLKPSSGMNWKELGENDDLATSLVLDPYLNFTTHKMNTRFRPVDARKEY
LRDIILRFKKSHNYERAYKGLVSGDWARVFFLNKSKHQVTIFKQHVFRYLAMFDKTSGFE
VKPCFRYSLEGAGGKIVATRVWSKSDTILNLVGCIAELTECEENSLKTGVNDFSVMFSTR
KNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEITCFYGDGFFGEGNC
HCECETCERRQMGAFTPKDMPVKIDENKYSLRDTDRRLRWQKAKNEEEGGPSQEEGSVVK
SVLPSRLLRRSDSECSGSSDGSSCPWSRSRSSQPLSPSFLANQTLVDLIAEKKCLSKYDA
QLLVAEGYKLREAKVVLTPHKIKEDGTLTVEEGGVRYASRLRREERRKAGREGRERRMSL
NEEPVPSPRVEEAHLNGGIVDTEAVECVAASRTERRRSRESRKRRVSATEEMQELSKLPR
ETCLDPSGGVEGVSSVPGLRSRSGSVAAVGLALDQQSNCSSCDTEVTFNVRHLSKAPKAI
EKDLTYESEISDCETKLKIRGVPRDRAIAGKRNLLDDGPARTNRHGGKRERRETDCSKNC
KDLKVKHGKSEGLEVPPLILPKRKMTKYDAELIAEAVQKIPKLKIRMKDSNGCIEEVVTS
SEDEVSPRQHSVSCESSSITTSQDQKLLLDVPDSPSRLTRGQRVLIPGPKLPQSPTSTSK
TDSPPASPSLLRARANLKFNSPERKKTSHQFVPRMSQLRHLYEIPPHPILQKVDKSVPPK
HINSSDVKTFYPSFPDSPKTEHLSDVLKSEESPSQTFQVSVKPVDNRNTRKIRLIFGQRT
MDIQLPKTGKCYPTKSKPL
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtattgatggaacaggccctggctggccgctgaagcccagctctggtatgaac
tggaaggagctgggtgagaacgatgacctggccaccagcctggtccttgacccctacctc
aacttcaccacgcacaagatgaacacaaggttccgccctgtggatgcaaggaaggaatac
cttcgggacatcatcctgcgcttcaagaagtcccacaactacgagcgggcctacaagggc
ctggtgtcgggcgactgggccagggtcttcttccttaacaagtccaagcaccaagtgacc
atcttcaagcagcatgtgtttcgctatctggcgatgttcgacaagacgtctgggtttgag
gtgaagccctgcttccgctactctttggaaggggcaggaggaaaaattgtggcgacccgg
gtttggagtaagagtgatacgattctcaacctggtgggctgcatcgccgagctgacagag
tgcgaggagaactccctcaagacgggcgtcaacgatttcagtgtcatgttctcgaccagg
aagaactgtgcccagctgtggctgggcccggcagccttcattaatcatgattgtcggcca
aactgcaagtttgtttctacgggtcgcgacacagcctgtgtcaaagtactacgggacatt
gaacccggagaggaaatcacctgtttctatggcgacggattctttggggaaggcaactgt
cactgtgaatgtgaaacctgcgagcggaggcagatgggtgccttcacccccaaagacatg
ccggttaagattgatgagaacaagtacagcctgagggacaccgaccgacggctgcgctgg
cagaaagccaagaatgaagaggagggcgggcccagccaggaggagggcagtgtggtgaag
agtgtgttgccctctcggctgctgcggagaagtgattccgaatgtagcggaagctctgat
ggtagcagttgcccctggagtcgctcgcgctcctcccagcctctctctccatccttcttg
gctaaccagaccctggtggacctcattgctgagaagaagtgcctctcaaagtacgatgct
cagctgctggtggcagagggctacaaactcagggaagccaaggtggtcctgacgccccac
aagatcaaggaggatggcacactgactgtggaggaagggggtgtgaggtacgcctccagg
ctgcgcagggaggagcggaggaaggctggcagggagggccgtgagaggcggatgtcacta
aatgaggagcctgtgccctcgcctagggtcgaggaggctcacctgaatgggggcatagtt
gacacggaggcagtcgagtgtgtggctgcttccaggacagaacggaggcggtccagggag
tctcgcaagcgaagggtgtctgcgacagaggaaatgcaggaattatcgaagcttccccga
gaaacctgtctggatccaagtggaggggtggagggggtgagcagtgtccctggtctgagg
tctaggtccgggtcggtggcagcggtgggattggccctggaccaacagtccaattgcagt
agctgtgacaccgaggtgacgtttaatgtcagacatttgtcaaaggctccgaaggccatt
gagaaagatttgacgtacgaatcagagatctcggactgcgagacgaagcttaagatccgg
ggagtgccgagagatcgggccattgcagggaagcgcaaccttctagatgatgggcctgcc
agaactaatcgacatgggggaaagagggagcgcagagagacagattgtagcaaaaactgt
aaggatctgaaagttaagcatggcaagtcagagggattagaagtgccgcctctcatttta
cccaaacgcaagatgacaaaatacgacgcggaattaatcgctgaagcagtgcaaaaaatc
cccaagttgaaaatccgtatgaaagattctaatggctgtatagaggaagttgtcacatcg
tcagaggatgaggtgtcaccaagacagcattcagtgtcgtgcgaaagcagctccatcacc
actagtcaagaccagaaacttctccttgatgtccccgactccccgagtcgcctgactcga
gggcagcgggtcctcatccccggacccaaactcccccagtcacctacctccacctccaag
actgattcccctccagcttccccgagtctcctcagggcacgggctaatttgaagtttaac
tcaccggagcggaagaagacaagccaccagtttgtacctcggatgtcgcagctgcgtcac
ctttatgagatccctccccatcccatcctccagaaggttgacaaaagcgtgcctccaaag
catattaactccagcgatgtcaagaccttctatccctcctttccggacagtccaaaaaca
gagcatctgagcgatgtgctcaaatcagaagagagtccttcccagaccttccaagtgtca
gtgaagccggtcgataacaggaacacccgcaaaatccgactgatatttggacaaaggacg
atggacattcagttgccaaaaacgggaaagtgttatcccacaaaatcgaaacctttatga

DBGET integrated database retrieval system