KEGG   Acanthaster planci (crown-of-thorns starfish): 110984510Help
Entry
110984510         CDS       T05078                                 

Definition
(RefSeq) histone deacetylase 8-like
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110984510
Chromosome and associated proteins [BR:aplc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110984510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110984510
NCBI-ProteinID: XP_022100459
LinkDB All DBs
Position
Unknown
AA seq 637 aa AA seqDB search
MSSSNKVTGERSPGSSPASPTTCHLHQPQEDQLTNVKSPPPAVPSEPLRGGAGADADGGP
STSTSMSDRLLQRLELLAENVPPARDAPLSPARASLSVEKSLHMYYSMKRTETFSTLYDF
DCSSSTTSSSSEKLLQRLEELSENIPPGFLASPDRSPLIGKSLPLLKRTDDSCATYDFDG
SSSASSTTSENVSKRLEQLSEYVRPRLSPGRSVCPGMAAGGSRVRKRSAPTPLKPLNRLA
PPKLKRRGVGGSRWETSSGDKINQVSTSSGVVYVYSEPLIKLCDTLLKVPKRAGMVHSLL
EAYGLLQNMTVLPPHLTTKEDLTVFHSQDFVDCLERLNQEDDSEKNEELKLQFGLGYDCP
TIPHVFDFVCLAAGATLRAAQALVHGESRVAINWCGGWHHAKRDEASGFCYVNDVVLGIL
KLREKFDRVLYLDLDLHHGDGVEDAFCYTPKVLTCSFHKYCPGFFPGTGSLDDVGIGKGK
FYSVNVPLKDGIQDNQYFSIFCRVVDQIKQCYRPSAVVVQCGADTLADDPMQSFNLTPAG
LARCLHHVTTAWQLPALLLGGGGYRLANTARCWANLTSTVLGCRLPAEIPEHEHFLEYGP
DYQLDISPTHRPNLNSDEYIEKIIASITDNLEKISDG
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctagtaacaaggtgacaggtgaaaggtcaccaggttcctccccggcatccccg
accacctgtcacctgcatcaaccacaggaagaccagcttaccaatgtgaaatccccaccc
cccgctgtgcccagtgagcccctgaggggtggggctggcgcagatgcagatggtggtccg
tccacctccacgtcaatgtcggacagactcttgcagcgcctggagctcctggccgagaat
gtgcccccggcccgtgacgcgcccctatccccggcccgggccagcctgagcgtagaaaaa
tccctgcatatgtactactccatgaagcggaccgagaccttcagcaccttgtacgacttc
gactgcagctcctccaccacctccagctcctcggaaaagcttctccaacgcctcgaggaa
ctctcggagaacatccccccgggattcttagcctcaccggaccgctctccgctgattggc
aagtccctgcctttactgaagaggaccgacgactcctgcgcgacctacgactttgacggt
agctcgtctgcatcctcaactacctcggagaacgtctccaaacgtcttgagcagctcagc
gagtacgtgaggccaagactctccccgggacgctcggtttgtcccggaatggcagctggt
ggttccagggtgcgaaagcgtagcgcgcctacacccctgaaaccgttgaatcggctggcc
ccaccgaaattaaagcgccgtggtgtgggtggctctcggtgggagacctcctctggagac
aagattaatcaggtgtcgacctcttctggagtggtttacgtctatagtgagccacttatc
aaattgtgcgatacattgctgaaagttccaaagagagcaggaatggtccacagtctactg
gaagcgtacggcctcctgcagaacatgacggtcctgcctccccatctcaccaccaaggaa
gacctgaccgtgttccactcccaggactttgtggactgcctagagcggctgaaccaggag
gacgacagtgagaaaaacgaggaactcaagctgcagttcgggctggggtacgactgtcca
accatccctcatgtctttgacttcgtctgcttggcggctggtgccacattgagggcagcg
caggcattggtgcacggggaaagcagagtcgctatcaattggtgcggaggctggcatcat
gccaagagagatgaagcctccggtttctgctacgtcaatgatgtcgttctcggcatcctg
aaactcagggagaagtttgaccgtgttctgtatttggacctggatttacaccacggggat
ggggtcgaggatgccttttgctacactcctaaggtcctgacctgctccttccacaagtac
tgcccgggtttctttccaggcaccgggtcgttggacgatgttggcatcggcaaaggcaag
ttctactcagtgaatgtcccactcaaggatggaatccaagacaaccagtacttcagcatc
ttctgcagggtggtggatcagatcaagcagtgctaccgccccagcgccgtggtggtccag
tgtggggccgacacacttgctgacgaccccatgcagtccttcaacctgacacctgccggg
ctggcccgctgcctgcaccacgtcaccacagcctggcagctgcctgcactgctgctgggc
ggcggcgggtacaggctggccaacacggccaggtgctgggccaatctgacgtcaacagtg
ctggggtgtcgcctgcctgcggagatacccgaacatgagcattttctggagtacggacca
gactatcagctggatatatccccaacgcacaggcccaacctcaactccgacgagtacatt
gaaaagatcatagcctccataacagataatctggagaagatttctgatgggtaa

DBGET integrated database retrieval system