KEGG   Acanthaster planci (crown-of-thorns starfish): 110987240Help
Entry
110987240         CDS       T05078                                 

Definition
(RefSeq) alpha-amylase 1-like
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aplc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110987240
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     110987240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 716 aa AA seqDB search
MKILCLLALLIGSAVGQWEPNTAYNRQVIVHLFEWKWTDIAEECERYLAPNGFGGVQISP
PSEHREVWSPWRPWWERYQPVSYKLTSRSGPESQLRDMVKRCNNVGVRIYVDAVINHMGA
GDSGTGTAGSWYDVGTLSYPGVPYSSLDFNVPNGKCNSGNGDIQSYQDVIQVRNCNLVGL
PDLDISKSYVRSKIVGYLNELIDIGVAGFRVDACKHMWPGDLNALSGSLNDLNTAYFSVG
SRPFIFQEVIDQGGEPITAGEYTAYGRVTEFKYGLRLGEAMRGYNKLTYFSNFGEAWGML
ADTSALVFVDNHDNQRGHGGGGNIITFENPRLYKMANAFMLAFPYGITRVMSSFYFNHDT
DAGPPADENGNTQSVTINADGTCGNGWVCEHRWRQIKNMIGFRNVAAGQPLSNWWSNGNQ
QIAFGRGDKAFIAINNDGHTLSETLYTGMPSGEYCNIILGDFDSSSGSCSGPTIHVDGSG
YAYFNVDTGDDPVAAIHTKAKVGDSSGSPVNPIDHINPGNPTGSQRTVIFIKKHTIIGQD
LFIRGGIDHTKRGGCTSNADTSACALPIHHNIGGTNTKFNAWKSGDDFLDWYGAESDQSS
YEGRTADGTPLVWTTNNPTNGGNVEADGYGYTPLNKWGDHYWMVDLNVDCDQTEAGWFEI
KAYLKNGAGWESDIWQGSCSGSAGGSKPYSSNNHFARCGYLNMFDFGSNSCTIENL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttgtgtttactggctctcctgattggctctgcggtgggtcaatgggagccc
aatactgcttataacagacaagtgatagttcacctattcgagtggaaatggactgacatt
gctgaggaatgcgagagataccttgcaccgaatggtttcggtggtgtccagatttcccca
ccgtccgagcaccgtgaggtgtggagtccttggcgaccgtggtgggagcgctaccagcct
gtcagttacaagctgaccagtcggtccggcccggaaagccagctacgggacatggtcaag
agatgcaacaacgtgggcgtcagaatttacgtggacgccgtcatcaatcacatgggagcc
ggagactctggaaccggtacggcaggcagttggtatgacgttgggacgttgagctacccc
ggagtaccgtacagtagcctcgacttcaacgtaccaaacggaaaatgtaactctggcaat
ggagacatccagagctaccaagacgtcattcaggtccgcaactgtaacctcgtgggtctg
ccagaccttgatatctccaagtcgtacgtgaggtccaagatcgtgggctacctgaatgaa
ctgatcgacatcggtgtggccggtttccgcgtcgacgcttgcaagcacatgtggcccgga
gacctgaatgccctctccgggtcactgaatgacctgaacacggcttacttctcagtagga
tcccggccgttcatcttccaggaggtcatcgaccagggcggggagcccatcacagcgggc
gagtacaccgcatacggccgggtgactgagttcaagtacgggttgagactgggggaggcc
atgagaggctacaacaagttgacttacttcagcaacttcggagaggcttggggcatgctc
gccgatacctcggccttggtcttcgtagataatcatgacaatcagcgcggccatggtgga
ggtggaaacatcatcacctttgaaaacccacgcctttacaagatggccaatgccttcatg
ctcgccttcccttacggcatcacgcgtgttatgagcagcttctactttaatcacgacact
gatgcaggtccaccggctgacgagaacgggaacacgcagtccgttaccatcaacgcagac
ggtacatgtggcaacggctgggtgtgcgagcatcgctggagacagatcaagaacatgata
ggtttccgtaatgtcgcagctggccagccgctttccaactggtggagcaatggtaaccag
cagatcgcctttggccgcggtgataaggcctttatcgccatcaacaacgacggccacacc
ttgtctgagactctatacaccggaatgccgtctggagagtactgtaacattattctgggt
gactttgactcttcgtcaggttcctgcagcggacccactatccatgttgatgggtccggc
tacgcatacttcaacgtggataccggagacgaccctgtagcggctattcacaccaaggct
aaagttggtgactccagtggttccccagtcaacccaatcgaccatatcaatccaggaaac
cccactggcagccagcgcactgtcatttttatcaagaagcatacaatcataggtcaagac
ctcttcatccgtggtgggatcgaccacaccaagagaggcggttgcacgtccaacgcagac
accagtgcttgcgccttacccatccatcacaacattgggggtaccaacaccaagttcaac
gcctggaagtcaggagacgatttcctggactggtacggtgcagagagtgaccagagcagc
tacgaaggaaggacggccgacggtacacccctcgtctggacgacaaacaacccaaccaac
ggaggcaacgttgaggccgacggctacggatacacgcccttgaacaagtggggcgatcac
tactggatggtggaccttaacgtggactgtgaccagacagaggctggttggtttgagatc
aaggcctacctgaagaatggagctggctgggagagcgacatctggcagggttcatgctca
ggatcggcaggcgggagcaaaccatactcaagtaacaaccatttcgccagatgcggctac
ttgaacatgttcgactttggctcaaattcatgtaccatagaaaatttgtag

DBGET integrated database retrieval system