KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_11320Help
Entry
Asphe3_11320      CDS       T01435                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, monomeric type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00020  Citrate cycle (TCA cycle)
apn00480  Glutathione metabolism
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01130  Biosynthesis of antibiotics
apn01200  Carbon metabolism
apn01210  2-Oxocarboxylic acid metabolism
apn01230  Biosynthesis of amino acids
Module
apn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Asphe3_11320
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Asphe3_11320
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Asphe3_11320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ADX72314
UniProt: F0M4R8
LinkDB All DBs
Position
1187419..1189638
Genome map
AA seq 739 aa AA seqDB search
MSKIIYTHTDEAPMLATYSFLPIVEAFASTAGVEVETRDISLAGRIIAVFGDYLTPEQQI
GDALAELGELAKTPEANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDNPSSDEETAI
RSRYDKIKGSAVNPVLREGNSDRRAPLSVKNYARQNPHSMGAWTPESKTNVATMGQDDFR
SNEKSVVMESEGTIAIQLVREDGSVKVLKKAFPVLAGEVIDGTVMRAAALDEFLKAQVAR
AKEEGVLFSAHLKATMMKVSDPIIFGHVVKAYFSELFDTYGKQLAAAGISPNNGLAAILS
SLEDLPEDVRDGVQNLIKKGLEEGPALAMVDSDKGITTLNVPSDVIVDASMPAMIRSSGH
MWGPDGKEADTLAVLPDSSYAGIYQVVIDDCRANGAYDPTTMGTVPNVGLMAQAAEEYGS
HDKTFEIQEAGTVQIVDGSGNVLIEHQVSVGDIWRACQTKDLPIRDWVKLAVTRARASQT
PAVFWLDEERAHDANLIAKVNEYLKDHDTEGLDIRIMSPVKAIAFTLERIRKGEDTISVS
GNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLLKENHLRWD
SLGEFLALAVSFEHLATTTDNKRAQVLADTLDRATGTFLLENKSPSRRAGELDNRGSHYY
LARYWAEELAKQTDDADLAAAFSSIASELSSKEETIVGELAEVQGSPVDIGGYYHPDDAK
ASAVMRPSATLNKVLATLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagattatctacacccacaccgacgaagcgccgatgctggctacctattcgttc
ctgcccatcgtcgaggcgttcgcttcgacagcaggtgtggaggtggagacccgcgacatt
tcgctcgccggccgcatcatcgccgtcttcggtgactacctgacccccgagcagcagatc
ggtgacgcccttgctgaactcggtgagctggcgaagacgccggaagccaacatcatcaag
ctccccaacatcagtgcctccatcccgcagctgaaggcagcgatcgccgaactccagggc
cagggttacgccctcccggactacccggacaacccctcctcggacgaggaaacggcgatc
cgctcccgctacgacaagatcaagggctccgccgtgaacccggtgctccgcgaaggcaac
tcggaccgccgcgcaccgctgtccgtcaagaactacgcacgtcagaacccgcactccatg
ggtgcctggacccccgagtccaaaaccaacgtggccaccatgggccaggacgacttccgc
tccaacgagaagtccgtggtcatggagtcagagggcaccatcgccatccagctggtccgc
gaggacggctccgtgaaggtcctgaagaaggccttcccggtcctggccggcgaggtcatc
gacggcacggtgatgcgcgccgccgccctggacgagttcctgaaggcgcaggttgcccgc
gccaaggaagagggcgtcctgttctccgcccacctcaaggccaccatgatgaaggtctcg
gaccccatcatcttcggccacgtggtgaaggcctacttctccgagctcttcgacacctac
ggcaagcagctcgccgccgccggcatcagccccaacaacggcctcgccgccatcctgagc
agcctcgaggacctccccgaggacgtccgcgacggcgtgcagaacctcatcaagaagggc
ctcgaagaaggccccgccctggccatggtggactcggacaagggcatcaccaccctgaac
gtccccagcgacgtcatcgtggacgcctccatgcccgccatgatccgcagctccggccac
atgtggggcccggacggcaaggaagcagacaccctggccgtgctgccggacagctcctac
gccggcatctaccaggtggtcatcgacgactgccgcgccaacggcgcctacgaccccacc
accatgggcaccgttccgaacgtcggcctcatggcgcaggccgccgaggaatacggcagc
cacgacaagacgttcgaaatccaggaagccggcaccgtccagatcgtggacggctccggc
aacgtcctgatcgaacaccaggtgtccgtcggcgacatctggcgcgcctgccagaccaag
gacctgcccatccgcgactgggtcaagctggccgtcacccgcgcccgcgcctcccagact
ccggcagtgttctggctggacgaggagcgtgcgcacgacgccaacctcatcgccaaggtc
aacgagtatctcaaggaccacgacaccgagggcctggacatccgcatcatgtccccggtt
aaggccatcgccttcaccctggagcggatccgcaagggcgaggacaccatttccgtttcg
ggcaacgtcctccgcgactacctcacggacctgttccccatcctggaactgggtaccagc
gccaagatgctctccatcgttccgctgatgaacggcggcgggctctttgaaaccggcgcc
ggcggatctgccccgaagcacgtccagcagctgctcaaggaaaaccacctgcgctgggac
agtctgggcgagttcctggccctggccgtcagcttcgagcacctggccaccaccacggac
aacaagcgcgcccaggtcctggccgacacccttgaccgtgccaccggcaccttcctgctg
gagaacaagtccccgagccgccgtgcaggggagctggacaaccgcggcagccactactac
ctggcccgctactgggccgaggaactggcaaagcagacggacgacgccgacctggccgcc
gcgttcagctccatcgccagtgagctgtcctccaaggaggagacgatcgtgggcgagctg
gccgaggtgcagggctccccggtggacattggaggctactaccacccggacgacgccaag
gcttcagccgtgatgcgtccttccgcaacactcaacaaggtcctggcaactctcagctag

DBGET integrated database retrieval system