KEGG   Accumulibacter phosphatis: CAP2UW1_3910Help
Entry
CAP2UW1_3910      CDS       T00966                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
app  Accumulibacter phosphatis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4472257..4475091)
Genome map
AA seq 944 aa AA seqDB search
MTSGEAREARFDERSPEISTRLLRVVTAMVEETRPGRAGRVSLTSHLERDLGLDSLARVE
LLLRVGSEFGRSLPDAALAEAETPQDLLRFVASAGVEAFSGELVELATASGLTSVPAQAA
TLVEVLEWHAERNPQRTHVLLYGDGGSEQGSFRAEAISYAELLEQSRRVATSLVTRGLLP
RQAVALMLPTGRDYLTSFFGVMLAGGIPVPIYPPARLAQLEDHLRRHARILANAEAAFII
TVPQAKGVAALLRAEAPSLTEVLTPAELDSEPIGLLYRAAPADIAFLQYTSGSTGEPKGV
VLTHANLLANLRAMGEAVAVTSDDVFVSWLPLYHDMGLIGAWFGSLYFGMRLVLMSPLAF
LSRPVRWLRAISHHRGTLSPAPNFAYDLCARKLADADLQGLDLSSWRLALNGAEPVSPLT
LQAFAERFAPYGLHPEALTPVYGLAECSVGLAFPPLGRGPRVDRVQRAALVGRKHARSAD
SGDTDALCVPACGRVLPGHEIRVVDEQNGELPDRYVGRLQFRGPSATAGYYRNPVATQAL
FRDGWLDSGDFAYTVDGEIYLTGRVKDLIIRGGRNLYPYELEQAVGSIPGVRRGCVAVFA
SNDPVNATERLVVMAETREEDADRREILRQKINEAAVAAVGMPADEVVLAPPNSVLKTSS
GKIRRSASRDAFEHGLIGAGRAPVRLQLLRLAVAALRARLAESVLRVARGAYGAWCWTVF
TLLAIPVIGLVIALRAPPIGRRVVHRAARIFLFLAAMPVPRTATAKLPSSPHLLLANHCS
YLDALALCASLPPTWAYSFVAKREFVGQPVVHTFLRALGTLFVERFEASKSAEDVGEIVA
ALGRGQNLVIFPEGTFSREAGLKPFRMGAFVSAVRAHVPVLVGALQGTRAILRDRTWMPR
HGQLSLHIGQRLVPSGDDWGAAVRLRDATRQEMLRLCGEHDLER
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcggagaggcgcgcgaggctcggtttgacgagcggtcgcccgagatatcgaca
aggctgctgcgtgtggttacggcgatggtcgaggaaactcgtccagggcgggccgggcgc
gtgagtctgaccagccacctcgaacgcgacctgggcctggacagtctggcgcgggtcgaa
ctgctgttgcgggttggcagcgagtttggccggtcgctgccggacgccgcactggccgag
gccgagacgccgcaggacttgctgcgattcgtggccagtgcgggtgtcgaggctttctcg
ggcgaactcgtcgaactcgcgacagccagcggtctgaccagcgttcctgcccaggcagcg
acgctggtcgaggttctcgagtggcacgctgaacgcaatccacaacggacgcacgtcctg
ctttacggcgatggcgggagcgaacagggctccttccgggcggaagcgatttcctacgcc
gaactgctggagcagtcgcgccgtgtcgccacctctctggtgacgcgtggtttgctgcca
cggcaagccgtcgcgctgatgctgcccaccgggcgcgactacctgaccagctttttcggc
gtgatgctcgccggcggcattccggtgccgatctatccgccggcccggctcgctcagctc
gaggaccacctgcgacggcacgcgcgtatcctggccaacgcggaagccgcgttcatcatc
accgtgccgcaggcgaaaggggtggccgcgctgctgcgtgcggaggctcccagcctcaca
gaagtcctcaccccggcagaactcgacagcgaaccgatcggcctgctttaccgggctgca
ccggcagacatcgccttcctgcaatacacgtcgggcagtaccggcgagcccaaaggcgtt
gtcctgactcacgccaatctgctggccaacctgcgcgcgatgggcgaggcggtagcggtg
accagcgacgacgtcttcgtttcctggctccccctttatcacgacatgggactgattggc
gcgtggttcgggtcgctctatttcggtatgcggctggtgttgatgtcgccgctggccttt
ctctcccggccggtgcgctggctgcgtgccatctcccatcatcgtggcaccctctccccg
gcgccgaacttcgcctacgacctgtgcgcgcgaaagctcgccgacgccgacctgcagggg
ctcgacctttcctcgtggcggctggcgctgaacggtgccgaaccagtgagtcccttgaca
cttcaggccttcgcggagcgcttcgcgccctacggcctgcaccccgaggcgctcaccccg
gtctacggtctggcggagtgctcggtcggtctggcttttccgccgctcgggcgtggcccg
cgcgtcgaccgggtccagcgtgcagccttggtcggcagaaagcacgctcggtcggccgac
agtggcgacactgatgcgctgtgcgtgccagcctgtgggcgtgtcctgccggggcatgaa
atccgcgttgtcgacgagcagaacggcgagttgccggaccgctacgtcgggcgcctgcag
tttcgcgggccgtcagcgacggccggctactatcgcaatccggtggcgacgcaagccctg
tttcgtgacggctggctcgattcgggtgatttcgcctataccgtcgacggtgagatctat
ctgaccggcagggtcaaggatctgatcattcgcggcgggcgcaacctttatccctacgag
ctcgagcaggcggtgggcagcatcccgggcgtgcgtcggggctgcgttgccgtatttgcc
agcaacgatccggtcaatgcgaccgaacgcctggtggtgatggccgaaacgcgcgaagag
gacgcggatcggcgcgagattctccggcagaagatcaacgaagcggctgtcgcagcggtc
ggcatgccggccgacgaggtggtcctggcgccgcccaattcggtactcaagacgtccagt
ggcaagattcgtcgcagtgcctcgcgcgacgccttcgagcatggcctgatcggcgctggc
cgcgcgccggtacgcctgcagttgctgcgcctggcggtcgcggcgctacgcgcccgcttg
gccgaatcggtactacgcgtcgcccggggtgcctacggtgcctggtgctggacggtgttc
acgctgctcgccataccggtgatcgggctggttatcgctttgcgcgcgccgccaatcggc
cgccgcgtggttcatcgcgcggcgcgcatcttcctgtttctggcggctatgccggtaccg
cgtacggcgacggcgaagctcccgtcatcgccacacctgctgctggccaaccactgcagc
tatcttgatgcgctggctctctgtgcgagcctgccaccgacgtgggcctacagctttgtc
gccaagcgcgagttcgtcggacagccggtggtccacacttttctgcgtgccctcggcacc
ctgttcgtcgagcgcttcgaggcgtcgaaaagcgcggaggacgtgggcgagatcgtcgcg
gcgctggggcgaggccagaaccttgtgatcttccccgagggtactttctcgcgagaggca
ggcctcaaacccttccggatgggggcgttcgtgagcgccgtgcgggcgcatgtgccggta
ctggtcggcgctctgcaggggacccgcgccattctccgcgatcggacgtggatgccgagg
cacgggcagttgtcgctccacattggacaacggctcgtcccgagcggtgacgactggggt
gccgcggtccggctacgcgatgctacgcgccaggagatgctgcggctctgtggcgagcac
gatctcgaacgttag

DBGET integrated database retrieval system