KEGG   Anaerococcus prevotii: Apre_0677Help
Entry
Apre_0677         CDS       T00964                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
apr  Anaerococcus prevotii
Pathway
apr00010  Glycolysis / Gluconeogenesis
apr00230  Purine metabolism
apr00620  Pyruvate metabolism
apr01100  Metabolic pathways
apr01110  Biosynthesis of secondary metabolites
apr01120  Microbial metabolism in diverse environments
apr01130  Biosynthesis of antibiotics
apr01200  Carbon metabolism
apr01230  Biosynthesis of amino acids
Module
apr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
apr_M00002  Glycolysis, core module involving three-carbon compounds
apr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apre_0677
   00620 Pyruvate metabolism
    Apre_0677
  Nucleotide metabolism
   00230 Purine metabolism
    Apre_0677
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Apre_0677
Membrane trafficking [BR:apr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Apre_0677
Exosome [BR:apr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Apre_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACV28716
JGI: Apre_0677
UniProt: C7RGV5
LinkDB All DBs
Position
774560..776332
Genome map
AA seq 590 aa AA seqDB search
MKPEILKKTKIVCTIGPASEDPAILEELINNGMNVARLNFSHGTHEEHLAKIKTIRRIRR
KLNVPVAIMLDTKGPEIRTGNFNVDEIYLKPGDIFTLTTRDVEGDQSIVSVSYEGLPEDV
SVGSEIYIDDGLVQLEVIEIKDGTDVVCKALNNGILSDHKGVNLPGSKTNLPAITPKDVD
DIKFGIENDIDIIAASFVRKKEDVYDIRKVLEDHGGEHIKIISKIESQEGVDNVDEIIEA
SDGIMVARGDLGVEIRTELIPLVQKEVIRKCNDAAKPVITATQMLDSMIRNPRPTRAETT
DVANAIIDGTDCVMLSGETAGGKYPIEAVKTMRNICITTELSDDFYQNIYDVKIHSANTT
TNSIARSTKNIAEELNAKAIISCTASGNTSRVISKFKPKTNIIAATISDRVARQLSIVWG
VYPIVIQEATETDELIERAIVGALAENYVEEGDLTVVTAGIPLGVSGTSNLIKVHVIGDI
LTSGTGIGSKSVSGKVVIGSTKKELEGKFEEGDIIVAKFTDSDITEYIEKASAVVTETGG
LTSHTAVAAVHFGIPAVVGAVNVINLVEEGETITVDPIGGVIYKGETKVI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgaaattttaaaaaagacaaaaatagtatgtacaattggaccagctagtgaa
gatccagctatcctagaagaactaatcaacaatgggatgaacgttgcaagacttaacttc
tctcacggaactcacgaagagcacttagcaaagattaaaacaatcagaagaatcagaaga
aaactaaacgtgcctgtagctataatgctagatactaagggaccagaaatcagaactggt
aactttaacgtagatgaaatctaccttaaaccaggagatatcttcaccctaacaacaaga
gacgtagaaggtgaccaatcaatcgtatcagtttcttacgaaggactaccagaagatgta
tcagtaggaagcgaaatctatatagatgacggacttgttcaactagaagtaattgaaatt
aaagatggcacagatgtagtttgtaaggcactaaacaacggaattctttcagaccacaag
ggagttaacctaccaggctcaaagacaaaccttcctgctattacaccaaaagacgttgat
gatatcaaatttggtatagaaaatgacattgacatcatcgcagcatcttttgttcgtaaa
aaagaagacgtatatgatatcagaaaagtcctagaagatcacggtggagaacacatcaag
attatttctaaaatcgaaagccaagaaggtgtagataacgtagacgaaatcatagaagca
agtgatggaatcatggtagctagaggagacctcggtgtagaaattagaacagagcttatc
ccattagtacaaaaagaagtaatcagaaaatgtaatgatgctgcaaaaccagttatcaca
gctacacaaatgctcgactcaatgattagaaacccaagaccaaccagagctgagacaact
gacgttgccaacgctattatcgatggaactgactgtgtaatgctttcaggagaaacagct
ggtggaaaatacccaatagaagcagttaagacaatgagaaacatctgtatcacaacagag
ctatcagatgacttctatcaaaacatctacgatgttaaaattcactcagcaaacacaaca
accaactcaatagcaagatcaaccaaaaacatcgcagaagagctaaatgccaaggcaata
atctcttgtacagcaagtggtaatacatctagagtaatatctaaattcaaacctaagaca
aatataattgctgcaacaatctctgatagagttgctagacaactatcaattgtatgggga
gtatatccaatagtaatccaagaagcaactgaaactgatgagcttatcgaaagagcgata
gttggtgcacttgctgaaaattacgtagaagaaggagacctaacagtagtaacagcagga
atccctctaggagtatctggaacaagtaacctaatcaaagttcacgttattggagatatt
ctaacaagcggtacaggaattggaagcaaatcagtatcaggaaaagttgtaataggatca
acaaaaaaggaactagaaggtaaatttgaagaaggcgacatcatagttgcgaaattcact
gattctgacatcacagaatatatagaaaaagcctcagctgtagtaacagaaactggtgga
ctaacaagccacacagcagtagccgcagttcactttggaatccctgcagtagtaggagct
gtaaatgtaatcaatctcgtagaagaaggcgaaacaattacagtagacccaataggcgga
gtaatatacaaaggagaaacaaaagttatctaa

DBGET integrated database retrieval system