KEGG   Anaerococcus prevotii: Apre_0677Help
Entry
Apre_0677         CDS       T00964                                 

Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
apr  Anaerococcus prevotii
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Apre_0677
   01230 Biosynthesis of amino acids
    Apre_0677
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apre_0677
   00620 Pyruvate metabolism
    Apre_0677
  Nucleotide metabolism
   00230 Purine metabolism
    Apre_0677
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Apre_0677
Exosome [BR:apr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Apre_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
774560..776332
Genome map
AA seq 590 aa AA seqDB search
MKPEILKKTKIVCTIGPASEDPAILEELINNGMNVARLNFSHGTHEEHLAKIKTIRRIRR
KLNVPVAIMLDTKGPEIRTGNFNVDEIYLKPGDIFTLTTRDVEGDQSIVSVSYEGLPEDV
SVGSEIYIDDGLVQLEVIEIKDGTDVVCKALNNGILSDHKGVNLPGSKTNLPAITPKDVD
DIKFGIENDIDIIAASFVRKKEDVYDIRKVLEDHGGEHIKIISKIESQEGVDNVDEIIEA
SDGIMVARGDLGVEIRTELIPLVQKEVIRKCNDAAKPVITATQMLDSMIRNPRPTRAETT
DVANAIIDGTDCVMLSGETAGGKYPIEAVKTMRNICITTELSDDFYQNIYDVKIHSANTT
TNSIARSTKNIAEELNAKAIISCTASGNTSRVISKFKPKTNIIAATISDRVARQLSIVWG
VYPIVIQEATETDELIERAIVGALAENYVEEGDLTVVTAGIPLGVSGTSNLIKVHVIGDI
LTSGTGIGSKSVSGKVVIGSTKKELEGKFEEGDIIVAKFTDSDITEYIEKASAVVTETGG
LTSHTAVAAVHFGIPAVVGAVNVINLVEEGETITVDPIGGVIYKGETKVI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgaaattttaaaaaagacaaaaatagtatgtacaattggaccagctagtgaa
gatccagctatcctagaagaactaatcaacaatgggatgaacgttgcaagacttaacttc
tctcacggaactcacgaagagcacttagcaaagattaaaacaatcagaagaatcagaaga
aaactaaacgtgcctgtagctataatgctagatactaagggaccagaaatcagaactggt
aactttaacgtagatgaaatctaccttaaaccaggagatatcttcaccctaacaacaaga
gacgtagaaggtgaccaatcaatcgtatcagtttcttacgaaggactaccagaagatgta
tcagtaggaagcgaaatctatatagatgacggacttgttcaactagaagtaattgaaatt
aaagatggcacagatgtagtttgtaaggcactaaacaacggaattctttcagaccacaag
ggagttaacctaccaggctcaaagacaaaccttcctgctattacaccaaaagacgttgat
gatatcaaatttggtatagaaaatgacattgacatcatcgcagcatcttttgttcgtaaa
aaagaagacgtatatgatatcagaaaagtcctagaagatcacggtggagaacacatcaag
attatttctaaaatcgaaagccaagaaggtgtagataacgtagacgaaatcatagaagca
agtgatggaatcatggtagctagaggagacctcggtgtagaaattagaacagagcttatc
ccattagtacaaaaagaagtaatcagaaaatgtaatgatgctgcaaaaccagttatcaca
gctacacaaatgctcgactcaatgattagaaacccaagaccaaccagagctgagacaact
gacgttgccaacgctattatcgatggaactgactgtgtaatgctttcaggagaaacagct
ggtggaaaatacccaatagaagcagttaagacaatgagaaacatctgtatcacaacagag
ctatcagatgacttctatcaaaacatctacgatgttaaaattcactcagcaaacacaaca
accaactcaatagcaagatcaaccaaaaacatcgcagaagagctaaatgccaaggcaata
atctcttgtacagcaagtggtaatacatctagagtaatatctaaattcaaacctaagaca
aatataattgctgcaacaatctctgatagagttgctagacaactatcaattgtatgggga
gtatatccaatagtaatccaagaagcaactgaaactgatgagcttatcgaaagagcgata
gttggtgcacttgctgaaaattacgtagaagaaggagacctaacagtagtaacagcagga
atccctctaggagtatctggaacaagtaacctaatcaaagttcacgttattggagatatt
ctaacaagcggtacaggaattggaagcaaatcagtatcaggaaaagttgtaataggatca
acaaaaaaggaactagaaggtaaatttgaagaaggcgacatcatagttgcgaaattcact
gattctgacatcacagaatatatagaaaaagcctcagctgtagtaacagaaactggtgga
ctaacaagccacacagcagtagccgcagttcactttggaatccctgcagtagtaggagct
gtaaatgtaatcaatctcgtagaagaaggcgaaacaattacagtagacccaataggcgga
gtaatatacaaaggagaaacaaaagttatctaa

DBGET integrated database retrieval system