KEGG   Actinosynnema pretiosum: CNX65_10725Help
Entry
CNX65_10725       CDS       T05092                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00250  Alanine, aspartate and glutamate metabolism
apre00410  beta-Alanine metabolism
apre00640  Propanoate metabolism
apre00650  Butanoate metabolism
apre01100  Metabolic pathways
apre01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNX65_10725
   00650 Butanoate metabolism
    CNX65_10725
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CNX65_10725
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNX65_10725
Enzymes [BR:apre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CNX65_10725
Amino acid related enzymes [BR:apre01007]
 Aminotransferase (transaminase)
  Class III
   CNX65_10725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ATE53706
UniProt: A0A290Z3U9
LinkDB All DBs
Position
2366339..2367631
Genome map
AA seq 430 aa AA seqDB search
MAHDELLARHRAVLPDWMALYYDHPIEITRGSGRHVTDGEGRTYLDFFAGILTNGVGYDI
AEISDAIRSQIDTGVLHSSTLYLIRSQVELAERIAGLSGIPDAKVFFTNSGTEANETALM
LACGHRRSDQVLALRNSYHGRGFAATGVTGLRAWSPTALSPLKVAWVHGGYRYRSPFRDL
SDADYVAACVADLRDVLNTATSGDVACMIVEPIQGVGGFTLPPDGLFAAFKEVLDEHGIL
LISDEVQTGWGRTGEHFWGIGAHGVTPDAMTFAKGLGNGLAIGGVVARGDVVDGLTANSI
STFGGNPVSTAGALATLDYLLGHDLQSNAAKLGARLISGLRDVAADHPLLGDVRGKGLMV
GLELVGEDRAPDPAAAVAVLEATRERGLLVGKGGLHGNVIRLAPPLSVTADEVEEALVVL
RDAIAEVSAR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgacgagctgctggccaggcaccgggcggtcctgccggactggatggccctg
tactacgaccacccgatcgagatcacgaggggcagcggcaggcacgtcaccgacggagag
ggccgcacctacctcgacttcttcgcgggcatcctcaccaacggcgtcggctacgacatc
gccgagatcagcgacgccatccggtcccagatcgacaccggcgtgctgcacagctccacc
ctgtacctgatccgctcgcaggtggagctggccgagcggatcgccgggctgtccggcatc
ccggacgccaaggtgttcttcaccaactccggcaccgaggccaacgagaccgcgctcatg
ctggcctgcgggcaccgccgcagcgaccaggtcctcgccctgcgcaactcgtaccacggc
cggggcttcgcggcgaccggcgtcacgggcctgcgcgcctggtcgccgaccgcgctcagc
ccgctcaaggtcgcctgggtgcacggcggctaccgctaccgcagcccgttccgcgacttg
tccgacgccgactacgtcgccgcctgcgtcgccgacctgcgggacgtgctgaacaccgcc
acctccggcgacgtcgcgtgcatgatcgtcgaaccgatccagggcgtcggcgggttcacc
ctgccgccggacgggctgttcgccgcgttcaaggaggtcctggacgagcacggcatcctg
ctgatctcggacgaggtccagaccggctgggggcgcaccggcgagcacttctggggcatc
ggcgcgcacggcgtcacccccgacgcgatgaccttcgccaaggggctcggcaacgggctc
gccatcggcggcgtggtcgcgcgcggcgacgtcgtggacggcctgaccgccaactcgatc
tccacgttcggcggcaacccggtgtccacggcgggcgccctggcgacgctggactacctg
ctcggccacgacctccagtccaacgcggccaagctcggcgcccggctgatctccgggctg
cgcgacgtcgccgccgaccacccgctgctcggggacgtgcgcggcaagggcctcatggtc
ggcctggagctggtcggcgaggaccgcgcgcccgaccctgcggcggcggtggccgtgctg
gaggcgacgcgcgagcgcgggctgctggtcggcaagggcgggctgcacggcaacgtcatc
cgcctcgccccgccgctgtcggtgaccgccgacgaggtggaggaggcgctcgtggtgctg
cgggacgcgatcgcggaggtgtcggcccgatga

DBGET integrated database retrieval system