KEGG   Auxenochlorella protothecoides: CP73_p049Help
Entry
CP73_p049         CDS       T04132                                 

Gene name
rbcL
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
apro  Auxenochlorella protothecoides
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:apro00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CP73_p049 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CP73_p049 (rbcL)
Enzymes [BR:apro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CP73_p049 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MAPQTETKTSSGFKAGVKDYRLTYYTPDYQTKDTDILAAFRMTPQPGVPPEECGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYDLEPVAGEENQYIAYVAYPIDLFEEGSVTNLFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRSLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKSQAETGEIKGHYL
NATAATNEEVLKRAELAKDLGVPIIMHDYLTGGFTTNTTLAHYCRDEGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYIEKDRSR
GVYFTQDWVSLPGVMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGGDVIRAACKWSPELAAACEVWKEIKFEFDTVDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctccacaaacagaaacaaaaaccagttcaggttttaaagcaggtgttaaagattat
cgtttaacttattatactcctgattaccaaacaaaagatacggatattttagcagctttc
cgtatgactcctcaaccaggcgttccaccagaagaatgtggtgcagctgttgcagcagaa
tcttcaacaggtacttggacgactgtttggactgatggtttaactagtttagaccgttat
aaaggacgttgctatgatcttgaaccagtagcaggcgaagaaaatcaatatattgcatat
gttgcatatccaattgatctttttgaagaaggctctgtaacaaacttatttacatcaatt
gtaggtaacgtttttggatttaaagcacttcgtgcattacgtctagaagatcttcgtatt
ccaccagcatatgttaaaacgttccaaggacctccacatggtatccaagttgaacgtgat
aaacttaacaaatatggtcgttcattattaggttgtacaattaaaccaaaactaggtctt
tctgctaaaaattacggccgtgctgtatacgaatgtttacgtggtggtcttgattttaca
aaagatgatgaaaacgtaaactcacaaccttttatgcgttggagagaccgtttcttattt
gttgctgaagctatttataaatctcaagctgagactggtgaaattaaaggtcactattta
aatgcaacagcagctacaaatgaagaagtactaaaacgtgcagaattagctaaagatctt
ggtgtaccaatcattatgcacgattaccttactggtggttttactacaaatactacttta
gcgcattattgtcgtgatgagggtttattactacacattcaccgtgcaatgcacgctgta
attgaccgtcaaaaaaatcatggtatgcacttccgtgttttagcaaaagctcttcgttta
tctgggggtgaccatttacactcaggtactgttgtaggtaaactagaaggtgaacgtgaa
gttactttaggtttcgttgatttaatgcgtgatgattacatcgaaaaagatcgtagtcgt
ggtgtttactttactcaagactgggtatcattaccaggtgtaatgccagtagcttctggt
ggtattcacgtatggcacatgccagctcttgtagaaatttttggtgatgatgcttgttta
caatttggtggtggtactttaggacacccttggggtaatgcacctggtgctgctgcaaac
cgtgtagcacttgaagcatgtgtacaagctcgtaacgaaggtcgtgaccttgctcgtgaa
ggtggcgatgttattcgcgctgcttgtaaatggagccctgaattagctgcagcttgtgaa
gtatggaaagaaatcaaatttgaatttgatactgtagatactctataa

DBGET integrated database retrieval system