KEGG   Acidihalobacter prosperus: BI364_01505Help
Entry
BI364_01505       CDS       T04495                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
aprs  Acidihalobacter prosperus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aprs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BI364_01505
Enzymes [BR:aprs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BI364_01505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
308939..310360
Genome map
AA seq 473 aa AA seqDB search
MAEKKYSAGVKDYRQTYWQPEYVPLDTDILACFKITPQAGIDREEAAAAVAAESSTGTWT
TVWTDLLTDMDYYKGRAYRIEDVPGDDTCFYTFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAIRALRLEDVRFPIAYVKTCGGPPSGIQVERDKLNKYGRPMLGCTIKPKLGLSAKNYGR
AVYEALRGGLDFTKDDENVNSQPFMRWRDRFEFVMEAILKSEQETGERKGHYLNVTAPTP
EEMYKRAEFAKEIGAPIIMHDYITGGFCANTGLANWCRDNGVLLHIHRAMHAVLDRNPHH
GIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRAATLGWIDLLRESFVPEDRSRGIFFDQD
WGSMPGAFAVASGGIHVWHMPALVSIFGDDSVLQFGGGTLGHPWGNAAGAHANRVAVEAC
VEARNQGRELEKEGKEILTGAAQHSPELKVAMETWKEIKFEFDTVDKLDLGHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaaaaatacagtgccggtgtgaaagattatcggcagacatactggcagccg
gagtacgtgccgctggataccgacattctggcgtgcttcaagatcacgccgcaggctggc
attgaccgcgaggaagccgctgcggcagtagccgccgagtcgtcgaccggcacttggacc
accgtgtggaccgacctgctgaccgacatggattactataagggacgagcctaccgcatc
gaagatgtgccaggcgacgatacctgcttctacaccttcattgcctatccgatcgacctg
ttcgaagaaggttcggtggtcaacgtgttcacttccttggtgggcaacgtgttcggtttc
aaggcgattcgcgcgctgcgtctcgaagatgttcgtttcccgattgcctatgttaagacc
tgcggtggtccgccgagcggcattcaggtcgagcgtgacaaactcaataagtacggccgc
ccgatgctcggctgcaccatcaagcccaagctcggcctgtcggccaagaactacggccgt
gcggtctacgaggccctgcgcggcggcttggacttcacgaaggacgacgagaacgtcaat
tcgcagccgttcatgcgctggcgcgaccgtttcgagttcgtcatggaagccatcctcaag
tccgagcaggaaaccggcgagcgcaagggtcattacctgaacgtcaccgccccgacgccc
gaggaaatgtacaagcgtgcggagttcgccaaggaaatcggcgcgccgatcatcatgcac
gactacatcaccggcggcttctgcgccaacacgggtctggccaactggtgccgtgacaac
ggcgtgctgctgcacattcaccgcgccatgcacgcggtgctcgaccgcaacccgcaccac
ggcatccatttccgcgtgctgaccaagatcctgcgcctgtccggtggcgatcacctgcac
accggcaccgtggtcggcaagcttgaaggcgaccgtgccgcaacgctgggctggatcgat
ctgctgcgcgaatctttcgtgccggaagaccgctcacggggcatcttcttcgatcaggac
tggggctccatgcctggcgcgttcgctgtcgcctctggcggcatccacgtctggcacatg
cccgcgctggtcagcatcttcggcgacgactctgtgctgcagttcggtggtggcacgctg
ggccatccttggggtaatgcggcgggtgcgcatgccaaccgcgtggcggtggaagcctgt
gtcgaggcgcgcaaccagggtcgtgaactcgagaaagagggtaaagaaatccttaccggg
gctgcccagcattcgcccgaactcaaggttgccatggaaacttggaaggaaatcaaattt
gagttcgataccgtcgacaaactcgatctgggtcacaagtaa

DBGET integrated database retrieval system