KEGG   Acidihalobacter prosperus: BI364_04395Help
Entry
BI364_04395       CDS       T04495                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00250  Alanine, aspartate and glutamate metabolism
aprs00410  beta-Alanine metabolism
aprs00430  Taurine and hypotaurine metabolism
aprs00650  Butanoate metabolism
aprs01100  Metabolic pathways
aprs01110  Biosynthesis of secondary metabolites
aprs01120  Microbial metabolism in diverse environments
aprs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aprs00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BI364_04395
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BI364_04395
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BI364_04395
   00430 Taurine and hypotaurine metabolism
    BI364_04395
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BI364_04395
Enzymes [BR:aprs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BI364_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Ntox5
Motif
Other DBs
NCBI-ProteinID: AOU97331
UniProt: A0A1D8ILM3
LinkDB All DBs
Position
complement(906303..907676)
Genome map
AA seq 457 aa AA seqDB search
MVKKLLPDTDLAPTYGSRAMSEPVPKYALPDGEMAPQTAYQLIHDELMLDGNARLNLATF
VTTWMEPEAERLMAETFDKNMIDKDEYPQTAEIETRCVNMIARLFNVPDDGAAVGVSAIG
SSEAVMLAGMALKWRWRARREASGKSADKPNLILGANVQVVWEKFCRYWEVEPRYIPMRE
GRYVITPEEVLERIDENTIGIVAILGTTFTGEFEPIEAIHDAVVAHNKTHGLVVPLHIDA
ASGGFVAPFIHPDLRWDFRLPNVVSINASGHKYGLVYPGVGWAVWRSQEHLPEDLVFHVN
YLGGDMPTFTLNFSRPGNQIVGQYYNFLRLGRKGYTRIMSTLRDTATELAARISKLGPFD
LLSDGSAIPVFAFRLKDASRYSVYDVSERLRIRGWQVPAYTMPPEAQNIAVLRVVIREGF
SRDMADLLLNDLSKVVDELSASPPTHPKTADGRFHHG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaaattactaccagataccgatctcgcccccacctatggctcccgcgccatg
tccgagccggtgccgaaatatgccttgccggatggtgagatggcgccgcaaaccgcctat
caactgatccacgatgaactcatgctcgacggcaacgcacgcctcaatctggccaccttc
gtcaccacctggatggagcctgaggctgagcgattgatggccgagaccttcgacaaaaac
atgatcgacaaggatgagtacccacaaaccgccgagatcgagacccgctgcgtcaacatg
atcgcgcgtctattcaacgtccctgatgacggtgcggcggtaggcgtgtcggcaatcggc
tccagcgaggcagtgatgctcgccggcatggcgctcaagtggcgctggcgcgcgcgccgc
gaggcctccggcaagtctgccgacaaacccaatctgatcctcggcgccaacgtgcaggtc
gtgtgggaaaaattctgtcgctactgggaggtcgaaccgcgctacatccccatgcgtgag
ggacgctacgtgatcacgccggaggaggtgcttgagcgtatcgacgaaaacaccatcggt
attgtggccatcctcggcactaccttcaccggcgagttcgaacccatcgaggcgattcac
gatgccgtggtcgcgcacaacaaaacgcatggcctggtcgtaccgctgcacatagacgcc
gcgagcggcggtttcgtcgcacccttcattcacccggacctgcgctgggacttccgcctg
cccaacgtcgtctccatcaacgcatcgggccacaaatacggcctggtctaccccggcgtc
ggctgggccgtatggcgtagccaggagcacctgcccgaggacctggtgttccacgtcaac
tacctcggcggcgacatgcccacgtttaccctcaatttttcccgccccggcaaccagatc
gtcggccagtactacaatttcctccgtctcggccgaaagggctatacgcgtatcatgtca
acgctgcgggacacggccaccgaactcgccgcgcgcatctccaagctcggccccttcgac
ctgcttagcgacggtagtgcgattccggtcttcgcctttcgcctcaaggatgcttcacgc
tactcggtatacgatgtttccgagcgcctacgtatacgcggctggcaggtacccgcatac
accatgccgccagaggcccagaacatcgccgtactgcgtgtggtcatacgcgagggcttc
tcgcgcgacatggctgacctgctgctgaacgacctatccaaggtagtcgacgaactctcg
gcatcgccgcccacccaccccaaaaccgcggacggacgcttccaccacggctga

DBGET integrated database retrieval system