KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_07660Help
Entry
APA07_07660       CDS       T01813                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA07_07660
  Amino acid metabolism
   00310 Lysine degradation
    APA07_07660
   00380 Tryptophan metabolism
    APA07_07660
Enzymes [BR:apu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     APA07_07660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
795221..798235
Genome map
AA seq 1004 aa AA seqDB search
MAFRQKGHRGRSALWGGVKKKWSGLRWRTTQYLANGAYVPRGKEECEMAVSDVLATALNG
ANIAYLADLYAQWAKDPKSVDPSFDILFSSLGDDEAAVLKDAVGASWAPRPSIITGDEPA
PAPKGKGGPAGGLAAQDSLAIARLIRAYREYGHLEASLDPLGLKVPHKTEELDPATYGFG
EKDLNREVFIGSLLDPLLKGKNTAKVSEVIAALRSVYCESIGAEYMYARNHEQREWLRKR
LEGDNWRAHVTVEEQKVILANLTEAEGFEAFCQKRYVGAKRFGLEGGEISIPSLHAIIDS
CASQGVTSVAIGMAHRGRLNTLVNVVRKPYVAIFNEFAGGSFKPDNVEGSGDVKYHLGSS
TDVDVAGKAVHISLQPNPSHLEAVDPVVCGKVRAIQDDAGDTEKRLSSLGVIIHGDAAFA
GQGIVYETFAMSQLPGYRTGGTIHMVVNNQIGFTTNPECGHSGIYGTDVAKSIEAPVLHV
NGDDAEAVIYVSRLAADYRQAFASDIVLDIVCYRRHGHNETDEPVFTQPVMYKAIAAHDT
PHTLYAKRLVKAGVVTDDEVKAQWDAFHAKLDEDYKAAQSYKVNKADWLEGGWKGLVAAG
HDPERAFPETGVALDALRKIGEAITKVPEGFNLNSKIARQLKAKANMFSTGEGFDWATGE
ALGFGSLLLDGHRVRLSGEDCQRGTFSQRHAVWTDQVNQTPFTPLNHIQDKQAKIEIWNS
LLSEYGVVGFEYGYSVRNPQTLVLWEAQFGDFANCAQVIIDQFIASGETKWLRMSGLVML
LPHGYEGQGPEHSSARLERYLQLCAENNMFVCNITTPANYFHALRRQLKLDYRKPMILME
PKSLLRHKLAVSALADFGPGTRFKPVIGEIDDLGADNKVRRVVICSGKVYYDLLAERREK
GIKDVAILRLEQLYPFPEAALAAELKRYSEADIVWCQEETENGGAWHFADRRIEAALAAA
GHKAGRPQYVGRAAAASPATGLARIHAAEQADLVERALGLKKSG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggctttccggcaaaaaggacacaggggacgctccgcgctatggggcggagtgaagaaa
aaatggtccggtttacggtggagaacgacgcaatatctggccaacggcgcgtatgtgccc
cgtggcaaggaggaatgtgagatggcggtttcggacgtactggcaaccgctcttaacggt
gccaatatcgcttaccttgcggatctgtatgcccagtgggcgaaggatcccaaaagtgtg
gatccgtccttcgatattctgttcagctcattgggcgatgatgaagccgcagtgctgaag
gatgccgttggagcctcttgggcgccacgcccttccattatcacgggggatgaacccgca
cctgctccgaaaggaaaaggtggcccggctggtgggttggccgcgcaggatagtctggcc
attgcccggctgatccgtgcgtatcgtgaatacggccacctggaagcctcgcttgatccg
ctgggcctgaaggtgcctcataaaaccgaggaactggaccccgccacatacggttttggt
gaaaaagacctgaaccgcgaagtgtttattgggtcactgcttgatccgctgctcaagggc
aagaacacggccaaggtttccgaggttattgcggcactccgctctgtgtattgcgaaagc
attggcgcagaatacatgtatgcccgtaaccacgaacagcgcgaatggctgcgcaagcgg
ctggaaggcgataactggcgcgcccacgtaacagtggaagagcagaaggttatcttggcc
aacctgacagaagccgaaggttttgaggctttctgccagaagcgctatgtgggtgcgaag
cgttttggtctggaagggggcgaaatctccattccttccctgcacgccattattgattcc
tgtgccagccagggggtgacatctgttgccatcggcatggcgcatcgtggccgcttgaac
acgctggttaacgtggtgcgcaagccttacgtggccatctttaacgaatttgcaggtggt
tccttcaaaccagacaatgttgaaggttctggcgacgttaaataccaccttggctcctcc
acagatgtggatgtggcaggcaaggcggtgcatatctcgctccagcccaacccttctcat
ctggaagcagtggatccggttgtgtgcggcaaggtgcgcgccattcaggatgatgcgggc
gatacggaaaaacgcctgtccagccttggcgttatcatccacggtgatgccgcgtttgcc
gggcagggcattgtttacgaaaccttcgccatgtcccaactgccgggctaccgcacgggt
ggcaccatccatatggtagtgaacaaccagattggctttaccaccaatccggaatgtggg
cattcaggcatttatggcaccgatgttgcaaaatccattgaagcccctgtgctgcatgta
aacggtgatgatgccgaggcggtgatttatgtctctcgccttgctgcggattaccgtcag
gcttttgcaagtgacattgtgctggatatcgtttgctaccgtcgccacgggcataacgaa
acggatgagccagttttcactcagcccgtcatgtataaagctattgccgcgcatgatacg
ccgcacacgctttatgcaaaacgccttgtaaaagcaggcgttgtgacggatgacgaagtg
aaggcccagtgggatgctttccacgccaagctggatgaagattacaaagctgcccagtct
tacaaggtgaacaaggcagactggctggaaggtggctggaaaggcctggtggctgccggg
catgatccggaacgcgccttccccgaaaccggtgttgcactggatgcgctgcgcaagatt
ggcgaagccattacaaaagtgccagaaggcttcaacctgaattccaaaattgcccgccag
ctcaaggccaaggcaaacatgttcagcacgggtgaagggtttgactgggcaaccggtgag
gctctgggctttggctccctgttgctggatggccaccgtgtgcgtctttccggtgaagat
tgccagcgtggcacgttcagccagcgtcatgccgtatggacggaccaggttaaccagaca
ccgtttacgccgctgaaccatattcaggacaagcaggcgaaaatcgaaatctggaactcg
cttctttcagaatacggcgtggttgggtttgaatacggatattccgtgcgcaacccacaa
acgctggtgctgtgggaagcccagtttggtgattttgccaactgtgctcaggtaattatc
gatcagttcatcgcctcgggtgaaaccaagtggttgcgtatgtccggtttggtcatgctg
ctgccgcatggttacgaagggcaggggccggaacattcttctgctcgtctggaacgttat
cttcagctttgtgctgaaaataacatgtttgtttgcaacatcaccacgcccgcaaactac
ttccacgccctgcgccgccagctcaagctggattaccgcaagccgatgatcctgatggag
cccaagtctctgctgcggcacaaacttgcggtttccgctctggcagattttggtccgggc
acacgctttaaacccgtgattggcgaaattgatgatctgggcgccgataacaaggtgcgc
cgcgtggtgatctgttctggcaaggtctattatgatctgctggccgaacgccgggaaaaa
ggcatcaaggatgttgccatcctgcgtctggaacaactctaccccttcccggaagcagcc
cttgccgccgaacttaagcgctattctgaagcagacattgtctggtgtcaggaagaaacg
gaaaacggcggtgcatggcattttgcagacaggcggattgaagcagcccttgctgccgca
ggccataaggcaggccgcccgcaatatgtgggccgcgccgcagcagccagcccggccacc
ggccttgcccgtattcatgcggcagagcaggcggatctggttgaacgcgcattggggctg
aaaaagtctggctga

DBGET integrated database retrieval system