KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_24990Help
Entry
APA26_24990       CDS       T01816                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    APA26_24990
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    APA26_24990
Enzymes [BR:apx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     APA26_24990
Peptidoglycan biosynthesis and degradation proteins [BR:apx01011]
 Precursor biosynthesis
  Racemase
   APA26_24990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2706927..2708072)
Genome map
AA seq 381 aa AA seqDB search
MAVVNTVSSSARTLWPASRAGAVLTVNLSAIAENYRYLKSRLGKTACAAVVKADAYGLGV
AQVAPVLEKAGAEHFFVAHVDEGLALRPFLSPHTSVTVLHGPRPDAAEVCVRNNLRPVLN
SLEQVAVLRDLAAKMDKPLDVAIQLDTGMSRFGLSEADIHKLVASPELLKGLFVSLVMSH
LACADTPQNPANTMQRERFEAYARILPQAALSLSASSGIFLGPQFHFDLVRPGAALYGVA
PQNEGDNPLKPVVGLQAHILQIRHLSKGDRVGYGLTWQAHGPCRVATIATGYADGFARAG
AAAGCAWYKGYRLPILGRISMDSMTVDLSAVPEGLLEEDSMVELLNESYGVDAVAKAEGT
IGYEVLTSLGRRYHRVYAAAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttgtgaatactgtttcgtcctcagccagaacattgtggccggcatctcgcgcg
ggggctgttcttacagtcaacctgtctgccattgctgaaaattaccgctatcttaaaagc
cgactaggcaaaacagcgtgtgccgcagtggttaaggcggatgcctatgggctgggtgtt
gcgcaggtggcgcctgttttggaaaaagcaggtgcagaacatttttttgttgcgcatgta
gatgaaggacttgccctcaggccatttctctctcctcacacatcggtaacagtgttgcat
gggcctaggcctgatgctgctgaggtatgtgtacgcaacaatctgcggcctgttctgaac
agtttggaacaagttgctgttttgcgagatctggcagccaaaatggataagcctctggat
gtggctattcagcttgatacgggcatgtctcgttttgggctttcagaggcggatattcat
aaactggtggcgtctccagagcttctgaaaggcttatttgtcagtctggtgatgagtcat
ctggcgtgcgcagatacaccgcaaaatccagcaaacaccatgcagcgcgaacggtttgag
gcatatgcccgcatactgccgcaagcggcattaagcctttctgcatcatccggcattttt
ctggggccacagtttcattttgacctcgtgcgccccggagctgctttatatggcgtggca
ccacagaatgagggtgataacccgctcaagcctgtggttggcctgcaagcgcatattctg
caaattcgtcatttatccaagggagaccgggtcggttacgggttgacatggcaggctcat
ggtccatgccgtgttgccactattgctaccggttatgcagatggttttgcccgtgccggg
gctgccgctgggtgcgcttggtataagggctatcggctgccaattctgggccgaatttcc
atggattccatgactgttgatctttctgcagtgcccgagggtctgttggaagaagacagc
atggtggaacttctgaatgagtcgtacggcgtagatgctgtggccaaagcagaaggcaca
attggctacgaagtactgacatctctggggcggcgttatcatcgcgtttacgcagcggct
gcctga

DBGET integrated database retrieval system