KEGG   Amphimedon queenslandica (sponge): 100636150Help
Entry
100636150         CDS       T02284                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100636150
Enzymes [BR:aqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100636150
Chromosome and associated proteins [BR:aqu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100636150
   HMT complexes
    COMPASS/SET1 complex
     100636150
    COMPASS/SET1 complex (yeast)
     100636150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET N-SET
Motif
Other DBs
NCBI-GeneID: 100636150
NCBI-ProteinID: XP_019850094
UniProt: A0A1X7V9A2
LinkDB All DBs
Position
Unknown
AA seq 1071 aa AA seqDB search
MLPCFVAPWWLNRLFKAFHMSSEDLQHRRKNNYKLLVDPELVKGKKKLYRLNGAIPGKAP
IPDPKDPRVLKTILGADGSNVGLRVPRFKYDKFWTGSPPLREILISGLNELSTKGTIIKD
LCETVSPTFFVKFHRHLKSRVFLGSATVSFVKAGCGERAVNELNGAVVCGSKIAVELDDR
GDLAKEVYTSKDNRRFSVDSFKSDVTTPTIKPDDSAFFNNHENNRDDAFQSPTSFPTHTS
FQKFNLISMVKTKSLSSVEGSPHMSGCGLTTPTGTTPNSGISTKHAFDPILALKTCLLAK
KNKVASIPPLPPKEKAPPLPSEAPPPPPEAPPPQIGLEEISSEDEGPKKVGKTFFEEISG
EEGSPLVTRPQLIVEDISSCEEDGERGNGSVDMDISDTEQNSSQIIEINVRPLTAPAPHF
IQPPLPPPPFPSQTFLNYQLSSEGPKTPPSEVRGDCLDNGGSAHPRTRKNKFSPAKQWKV
PLAVTREEKRGQDVLYCALEQLSRILLRDVEKKLVESSAFPVLDEVWDKKESQRSKALGE
EPMETEERVKPQEPYRRMLPGLVPNRSRPQEDDESTTPITPRKRLMNFKIPLVGSMYRRD
NVMTATRRLHFNERGERDRRKRKNHYSDVLPRRKRRHRKEDKDERRSEYSQLSDISSEEW
PSDEGRRSKDRDKKKKERKENAFGPRTPSATSEEEEEFNKLLQEEEEEEEGQEEEKVDSD
SSLAFNEIFGSTSSSDFEADIASLRRPKKAMKLSEPAIKKPSDLIESELIATPPVKEDKE
EMEIERIAEYKKRGEGEEAAILNSFLEEGFDKEDMDMMRSAYVKLKRIYSELISDVSWSY
YPHNVVENNVTHSSGCARSEGYYKIDPSDKSRYLHHLRRSKASEDKDKNSAPPPTSSGRG
NRLNHRRVASLFTSGDVSRELQQYNQLKARKKQLTFAKSTIHNWGLFALETIPADEMVVE
YIGQVVRHGIADERERRYEAQGIGSSYLFRVDYDHVIDATKSGNFARFINHCCDPNCYAK
IITVGNQKKIVIYSKRDIRAGEEITYDYKFPIEDEKIPCLCGAPQCRGTLN
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgttgccttgctttgtggccccttggtggcttaatcggctatttaaagcttttcacatg
tcaagcgaggacctacaacacaggaggaagaacaactacaagctcctggtcgaccccgag
ctcgtgaagggcaaaaagaagctttacaggctaaacggagccatacctgggaaggctcca
attcctgatccaaaagacccaagagttttaaaaacgattcttggcgctgatggaagcaat
gttggactgagggtgccaagatttaagtatgataagttctggacaggctctcctccacta
agagagatattaatctctggcctcaacgagctttccaccaaagggactatcattaaagat
ctctgcgagacggtgtctccaactttctttgtgaagtttcacaggcatttaaagtcgagg
gtttttcttggcagtgccactgtgtcttttgtaaaggccggctgtggagagagagctgtt
aatgagcttaatggagctgtggtctgtgggtctaagatagctgtggagcttgatgataga
ggtgatcttgctaaagaggtgtacacaagcaaagacaatagaagatttagtgttgatagt
ttcaaatcagacgtcaccacgcctaccatcaaaccagacgactcggcattttttaataat
cacgagaacaatagagacgatgcatttcaaagccccacctcctttcccacccacacttcg
tttcaaaaatttaatttgatttcaatggtaaagaccaaatcactctcatcagttgaaggt
tcgcctcatatgagtgggtgtggcttgaccacgcctacaggtaccacgcccaactctgga
atatctacaaagcatgcatttgatccaatcctagcattaaagacttgtctgttagcgaaa
aagaacaaggttgcttcaatccctccccttcctccgaaagaaaaggctcctccccttccc
tcagaagctccaccccctccaccagaagccccgccccctcagattggactggaggagatc
agctctgaggacgaaggacctaaaaaggttgggaagacattttttgaagagatttcgggc
gaagagggttctccactagtgactaggccccagcttatagtggaggacatatctagttgc
gaggaagatggagagagagggaatggaagtgttgatatggacatttctgatacggaacaa
aatagctctcaaatcattgaaattaatgttcgtcctctcacagcccccgcccctcacttc
atccagcctcctcttccacctcctccctttccttctcaaacctttttgaactatcagctc
tcctctgaaggaccgaaaactccaccctcggaggtccgtggcgattgccttgacaacggt
ggctccgcccacccaaggactcgcaaaaataagttctcaccggcaaaacaatggaaggtt
cctttggcagtgactcgggaagagaagagagggcaggatgtgctttattgtgccttggag
cagctgtcaagaatattactgagggacgtggagaagaaactggtagagagttctgctttt
cctgtacttgatgaagtgtgggataagaaagagagtcaaaggtctaaagcccttggagag
gagcctatggaaactgaagaacgtgtcaaaccacaagagccttaccgtagaatgctccca
ggccttgttcctaataggtcacgcccacaagaagacgacgagtcgaccacacccatcact
cctagaaagaggttgatgaactttaagatcccgttggtgggtagcatgtacaggagggac
aatgtgatgactgctacaaggagactccattttaatgagaggggagagagagacaggaga
aagaggaaaaatcattattccgatgtgctccctaggagaaagaggagacacagaaaggaa
gataaagatgaaaggagaagcgaatattctcaactctctgatatcagcagtgaggaatgg
cccagcgacgaggggaggaggagtaaggacagagataaaaagaaaaaggaaagaaaggag
aatgcatttggtccacgtactccatcagcaactagtgaagaagaagaagaatttaacaaa
ctactccaagaggaggaggaggaggaggagggacaagaggaagagaaggttgacagtgat
tccagtctggcattcaacgagatatttggctctacgtcttcaagtgattttgaggcggac
attgcttcactgcgaaggccaaagaaggctatgaaactttctgagccagcgataaagaaa
ccctctgacttgatagagtccgaattgatagccacgcccccagtgaaagaggataaagag
gagatggagattgagagaattgccgagtataagaagagaggagagggtgaggaggcggcc
attttgaactcattccttgaagaaggtttcgataaggaagacatggacatgatgagatcg
gcttacgtcaaattaaaaagaatttactcggaacttatcagcgatgtctcgtggtcttat
tatcctcacaatgttgttgagaataatgtcacacattcgagtggttgtgccagaagcgaa
ggttactacaaaattgatccgtcagataaaagtcgatacttacatcatctacggcgcagt
aaagcctctgaagacaaagataaaaactctgctccacctcctacttccagtgggcgtggc
aacagattgaaccatcgtcgtgttgcgtcactcttcacttctggagacgtctcaagagaa
ttacagcaatacaatcaactgaaggctcgtaagaagcaactgacatttgctaaatccacc
attcacaactggggcctcttcgcattggaaactataccagcggacgagatggttgtggag
tacatcggtcaagtggtgagacatgggatagcagacgagagggagcgacggtacgaggct
caagggatcgggagcagttacttgtttcgtgtcgattacgatcacgtcattgatgcaact
aagagcgggaactttgccagattcataaatcactgctgcgatccaaactgctatgctaag
atcatcacagtcgggaaccagaaaaagattgtcatttattccaaacgtgacattcgagca
ggagaagaaataacgtacgactacaagttccccattgaagatgagaagatcccgtgctta
tgtggagccccgcagtgtcgtggtactctcaattag

DBGET integrated database retrieval system