KEGG   Amphimedon queenslandica (sponge): 105314257Help
Entry
105314257         CDS       T02284                                 

Definition
(RefSeq) uncharacterized protein LOC105314257
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 105314257
NCBI-ProteinID: XP_011406631
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MRMKIHGDLASGNCLKVKYIADYLGLSYRWIPVDIMQGESRKPDFLRINPMAQVPAVEFD
DGRCLAQSNAILRYLAQGSDLLPQEPYLQAKIDEMLFWEQYSHEPYIAVCRFEMVYRGKS
AAEREAWRVQRGEAALDFMQERLSEGEYLVMDRFSIADIALLAYTRLAPQGGFDLGARGH
IGRWIRRCEQRLRLTASTPARRLKPRERGFEGSPTGIARVRIIR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgaagatccatggcgatctcgcttccggcaactgcctcaaagtgaaatatatc
gccgattatctggggctttcctatcgctggatcccggtcgatatcatgcaaggtgaaagc
cggaagccggattttcttcgtatcaatcccatggctcaggttccggcggtcgaattcgac
gacgggcgctgccttgcacaatcgaacgccatcttgcgttatctcgctcagggcagcgat
ctgctgccgcaagagccttatttacaagcgaagatcgacgagatgctcttttgggagcaa
tatagccacgagccctatattgcggtttgccgcttcgagatggtctatcggggcaaatcc
gccgccgagcgagaagcgtggcgggtgcaacgaggggaggcggccctcgatttcatgcaa
gaacgactaagcgaaggggaatatctggtgatggatcgcttttccatcgccgatatcgcg
ctgctggcctatacccggctggccccgcaagggggattcgatctcggcgcaagggggcat
atcgggcgatggatccgacgatgcgagcaacgactaaggctgacggcttcgactcccgcc
cgccgattgaaaccccgagaacgaggattcgagggcagccctacggggatcgcaagggtt
cggataatccgctag

DBGET integrated database retrieval system