KEGG   Arthrobacter sp. ERGS1 01: AL755_01405Help
Entry
AL755_01405       CDS       T04085                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:are00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AL755_01405
   00790 Folate biosynthesis
    AL755_01405
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AL755_01405
Enzymes [BR:are01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AL755_01405
Exosome [BR:are04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL755_01405
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:are00537]
 Enzymes
  AL755_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
unnamed2:complement(299129..300808)
Genome map
AA seq 559 aa AA seqDB search
MATAALAACTVSAAGPALAATPDITAHGGAQRSTSSHVEDIKASIVDGPAKNVILLIGDG
MGDSEITAARNYAYGAAGRFPGIDALPLTGQYTTYALNKKTGGPDYATDSAASGTGWATG
TKSYNGAISVDVKGKAQKTMLQIAKANGLKTGNVSTAELQDATPAVQVASVSSRSCYGPV
ATTKSCPENALENGGAGSITEQMLNTRPDVSLGGGSATFAETAKAGAWTGKTLAQQAADR
GYTTVSTAAELAAVKDANADAPLLGLFAPGNMAVRWQGALATHTGGAEAPIKCTDNPERT
AAQPSLSQMTGKAIELLKDGPKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVTTAL
DFAKADGHTMVVVTADHAHSSQIIYPGSTTPGLTRSLTTADGETMTMAYGTADEGASQGH
TGSQLRIAAYGPGAANVVGLTDQTDLFFTVTRTLALDPAAVLPTASPSASPSPSTTAGTS
PTAATPSSSAPATASSAPALTLPGNQASTAAAAAATGGNDRPGSLAVTGTTVAGWVLAAM
ALVTGGVIMRRRRSASHAL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
ctggccaccgcggcactggccgcctgcaccgtgagcgcggcaggaccagccctggccgca
acaccggacatcacggcccacggcggcgcgcagcgctccacgtcatcacatgtggaggac
atcaaggcctcgatcgtcgacggccccgccaagaacgtcatccttctgatcggtgacggc
atgggagattcggaaatcacggccgcccgcaactacgcctacggcgcggccggccgtttt
cccggcatcgacgccctgccgctgaccggccagtacaccacctacgcgttgaacaagaag
acgggcggacccgactacgccaccgattccgcggccagcggcaccggctgggccacgggc
acaaagtcctacaacggcgccatctcggtcgacgtcaagggcaaggcccaaaagaccatg
ctgcaaattgccaaggccaacggcctgaagacgggcaacgtctccacggccgaactccag
gacgcaacgcccgccgtccaggtggcctcggtcagcagccgcagctgctacggccccgtg
gccaccaccaagagctgcccggagaacgcccttgaaaacggcggcgccggctccattacg
gagcagatgctcaacacccgtcccgatgtatcgctcggcggcggatcggccacctttgcc
gagaccgccaaagccggcgcctggaccggaaagaccctcgcccagcaggcagcggaccgc
ggatacacgacggtttcaaccgccgccgagctggccgccgtcaaggacgccaacgccgac
gcacccttgctggggctgttcgcaccgggcaacatggccgtccgctggcagggcgccctc
gccacccacacgggtggtgcggaggcgcccatcaagtgcaccgacaatcctgagcgcacc
gcggcccagccgtcgctgtcccagatgacgggcaaggccatcgagctgctcaaggacggc
ccgaagggcttcttcctgcaggttgagggcgccagcatcgacaagcaggaccacgccgcc
aacccctgcggccagatcggcgagaccgttgacctggacgaggcagtcaccacggccctg
gactttgccaaggccgacggccacaccatggtggtggtgacggccgaccacgcccacagc
agccagatcatctaccccggcagcaccacgccgggcctcacccgcagcctgaccacggcg
gatggcgaaaccatgaccatggcgtacggcacggccgacgagggcgcatcccaggggcac
accggctcccagctgcgcattgccgcctacggtcccggtgccgccaatgtggtgggactg
accgaccagacggacttgttcttcacggtgacccggaccctggcgctggatccggcggcc
gtcctccccacggccagcccgtcggcaagcccttcaccgagcacgacggcgggaacctca
ccgaccgccgcaacgccgtcgtcgtcggctccggcaacggcgtcgtccgccccggcactc
accctgcccggcaaccaggcgagcacggccgcagcggctgcagccaccggcgggaatgac
cgcccgggttcactggccgtcaccggcaccaccgtggccggctgggtcctggcggccatg
gcactggtgaccggcggcgtcatcatgcgccgccgcaggagcgcctcgcacgcgctctag

DBGET integrated database retrieval system