KEGG   Archaeon GW2011_AR20: QT11_C0001G0509Help
Entry
QT11_C0001G0509   CDS       T03843                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
arg  Archaeon GW2011_AR20
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arg00001]
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    QT11_C0001G0509
Enzymes [BR:arg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     QT11_C0001G0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(402286..403578)
Genome map
AA seq 430 aa AA seqDB search
MKRVYVGISADLLHHGHINVINEASKLGEVTIGLLTDKAIASYKRLPFLPYDQRKIIIAN
IKGVKDVIPQETLDYAENLRKIKPDYVVHGDDWQEGVQKKTREKVIEVLKEWGGQLVEVP
YTKNISSGQLNKALREIGYTPEIRMKNLRRLLNSKELVRILEAHNGLTGYIVENAKVEKN
GVIKEFDGIWISSLTDSLAKGKPDNEVIDFTSRLSTINNILESTTKPMVVDGDTGGNVEH
FASMVKTLERLGVSAVIIEDKTGLKRNSLLGTDVEQIQDTIENFSAKIKTGKKSQITNDF
MIIARIESLILKKGVWEALIRAKAYIEAGADAIMIHSKEKSFDEIKDFCKQYSKFENKVP
LVVVPSTYSHVTEKELIDNGINMVIYANHLIRAAYPAMKKTAESILLNERAYEIEDSLTS
INDIINLIPK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtctatgttggtataagtgcagatttattgcatcatggtcatattaacgta
atcaatgaagcaagtaaattaggagaagttactataggcttgttgacagataaagctata
gctagttataaaagactgccttttttaccttatgatcaaagaaaaattatcatcgcgaat
ataaaaggcgttaaagatgttattccacaagaaacattagattatgctgaaaatttaaga
aaaattaaaccagattatgttgttcatggtgatgactggcaagagggggtgcagaaaaag
actagagaaaaggtaattgaagttctaaaagaatggggtggccagttagtagaggtgcct
tataccaaaaatatctcttcaggtcagctaaataaagctttacgcgaaataggatatacc
cccgagataagaatgaaaaatttaagaagacttttaaattcaaaagaattagtaaggatt
cttgaggcgcataacggtcttacaggttatattgttgaaaatgctaaagttgaaaaaaat
ggcgtgattaaagaatttgatggaatctggataagcagcttaaccgattcattggcaaaa
ggcaagccagataacgaggttatagattttacttctagattatctacaataaacaacatc
ttagaatcaacaacaaaacccatggttgttgatggagatactggtggaaatgtagagcat
tttgcttcaatggttaagactttagaaagattgggagtttctgctgttatcatagaagat
aaaactggattaaagagaaattctctgcttggaacagatgttgagcagatacaggataca
atagaaaatttttctgccaagattaaaacaggaaaaaagagccagataacaaatgatttt
atgataatagcaagaatagaaagtctaattttgaaaaaaggggtgtgggaagctctcatt
agagcaaaggcatatatcgaagctggtgctgacgctataatgattcatagtaaagaaaaa
agctttgatgaaataaaagatttctgcaaacaatactctaaatttgaaaataaagttcca
ttggttgttgttccgtcaacatattctcatgtaacagaaaaagagcttatagataatgga
attaatatggtaatttatgctaatcatttaataagggctgcttatcctgcaatgaaaaaa
acagcggaatcaatacttttgaatgagagagcctatgaaattgaagattctttaaccagc
ataaacgacataataaatttaattccaaaataa

DBGET integrated database retrieval system