KEGG   Arthrobacter sp. LS16: AFL94_10025Help
Entry
AFL94_10025       CDS       T04078                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
arl  Arthrobacter sp. LS16
Brite
Enzymes [BR:arl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AFL94_10025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALD64201
LinkDB All DBs
Position
complement(2177970..2178599)
Genome map
AA seq 209 aa AA seqDB search
MAVYSLPELQYDYAALEPNISARIMELHHSKHHATYVAGANSALEQLAEAREKGEFGNIP
KLSKDLAFHLGGHTNHSIFWNNLSPEGGDKPEGELAAAIDDFFGSFDAFRGHFTASAMSL
QGSGWAVLAYDAIGGQLVIEQLYDQQGNVPVATIPLLMLDMWEHAFYLDYVNVKADYVKA
FWNIVNWADVQARFEAARNGAAGLIVPGK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctattcgctgccagaactgcagtacgactacgctgcccttgagccgaacatc
tcggctcgcatcatggagctgcaccactcgaagcaccacgcaacctacgttgccggcgcc
aactcggcactggagcagctggctgaggctcgcgaaaagggcgagttcggcaacatccca
aagctgtccaaggatctggccttccacctcggcggccacaccaaccactcgatcttctgg
aacaacctgtccccagaaggcggcgacaagcctgagggcgagctggctgccgcgatcgac
gacttcttcggttccttcgatgcattccgcggtcacttcaccgcgtcggccatgagcctg
cagggctccggctgggcagtcctggcatacgatgcaatcggcggccagctggtcatcgag
cagctctacgatcagcagggcaacgtcccagtggcaaccatcccgctgctgatgctggac
atgtgggagcacgccttctacctggactacgtcaacgtcaaggccgactacgtcaaggcc
ttctggaacatcgtgaactgggccgacgtccaggctcgcttcgaggctgcccgcaacggc
gccgccgggctgatcgttccaggtaagtaa

DBGET integrated database retrieval system