KEGG   Arthrobacter sp. LS16: AFL94_13940Help
Entry
AFL94_13940       CDS       T04078                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
arl  Arthrobacter sp. LS16
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:arl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AFL94_13940
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AFL94_13940
Enzymes [BR:arl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AFL94_13940
Bacterial toxins [BR:arl02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AFL94_13940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3019955..3021544)
Genome map
AA seq 529 aa AA seqDB search
MTAAENLSFQTLARRGHHGYRQYRIPALAVTTAGTVLAAYDGRPNLDDLPNTIDLLLRRS
TDHGQTWENQQVIRTGSGLEGFGDPSLLVDADTSRIFCFHAAGTRAGFFESAEGAQPVDE
VQHVDLSYSDDDGRTWSHRRLTAQLKRPGITGIFAAAGAGIQLRTGRHAGRLLQQMVVLY
HGRIRAASAYSDDHGESWRLGELTSAEANENKAVQLPDGRVLMNSRAPDQRLQAVSTDGG
HRYGELAPVTDLPDPGDNGSICALPSDGGQLLLLTNNRDAALRRNTVLSVSFDNGDHWSP
VQSICPGSSAYSTAALLADGSLGVLFERDGYQDIVFTKLGPGSLAPTALAEAAARYREDP
GSEFTMVLRSITPARPERWTSIGEEHVISATAGDWAGHIWKEIGQGYQDGVQVLGSREAQ
LANYGPVLPGLRAGDMLAFTGRFVNSSERALEVELLGNYDRAPGTGFGPASVPAGGQRLF
FTPTYTVTAEDLRAGRARVGFEVRGGSGSWSQEFEVDTAAGTIRSLPAR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcagaaaacctgagcttccagacgctcgcacgccgaggccaccacggttac
cgccagtaccgcattccagctttggcggtcacgaccgccggcaccgtattggccgcctat
gacggccgccccaacctggacgacctgcccaacaccatcgacctgctgctgcgacgcagc
accgatcacggacaaacctgggaaaaccagcaggtgatccgcaccggttccggccttgaa
ggcttcggtgatcccagcctgctggttgacgccgacacctcgcggattttctgcttccac
gccgccggcacccgcgcgggattcttcgaatccgccgaaggggcgcagcccgtggacgag
gtgcagcacgtggacctctcctactcggacgacgacgggaggacctggtcgcatcgccga
ctgaccgcgcagctgaagcggccgggcatcaccggcatcttcgccgccgccggcgcgggg
atccagctgcgcaccggccggcacgccggacgcctgctgcagcagatggtggtgctgtac
cacgggcggatccgcgccgcctcggcctactccgacgaccacggcgagagctggcggctc
ggcgagcttacaagcgccgaagcgaacgagaacaaagcggtccagctgcccgacgggcgg
gtgctgatgaattcccgggctccggaccagcggctccaagcggtgtccaccgacggcggg
caccgctacggcgagcttgcgcccgtgactgacctgccggatcccggggacaacggaagc
atctgcgcccttccctccgacggagggcagctgctgctgctgacgaacaaccgcgacgcg
gccctgcgccgcaacacggtgttgagtgtgtccttcgacaacggagaccactggagcccg
gtccagtcgatctgccccggcagcagcgcctactccaccgccgcgctgctggccgacggc
tcgctgggggtgctgttcgaacgcgacggctaccaggacatcgtcttcaccaagctcgga
cccgggagtcttgccccgaccgcgctcgccgaggccgccgcgcggtaccgggaggatccg
ggcagcgagttcaccatggtgctgcgctccatcaccccggcacggcccgagcgctggacc
agcatcggcgaggagcacgtcatcagcgccacggcgggggactgggcagggcacatctgg
aaggaaatcggccaggggtaccaggacggagtgcaggtcctgggatcccgcgaagcgcaa
ctggccaactatggcccggtgctgccggggttgcgcgccggggacatgctggcattcacc
gggcggttcgtcaattcctccgagcgggctctggaggtggaactgctcgggaactacgac
cgtgcccccggcacaggattcgggcccgccagcgtaccggccggcggccagcggctgttc
ttcacccccacttacaccgtgaccgccgaggacctgcgcgccggccgcgccagagtgggc
ttcgaggtccgcggcggctcaggaagctggagccaggagttcgaggtggacaccgccgcc
ggcaccatccggtcgcttccggcgcgctga

DBGET integrated database retrieval system