KEGG   Arthrobacter sp. PAMC 25486: ART_2256Help
Entry
ART_2256          CDS       T03487                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
arm  Arthrobacter sp. PAMC 25486
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:arm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ART_2256
   00650 Butanoate metabolism
    ART_2256
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ART_2256
   00280 Valine, leucine and isoleucine degradation
    ART_2256
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ART_2256
Enzymes [BR:arm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ART_2256
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ART_2256
Amino acid related enzymes [BR:arm01007]
 Aminotransferase (transaminase)
  Class III
   ART_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2339833..2341194)
Genome map
AA seq 453 aa AA seqDB search
MSDIQYRLAQKRQILGAFPGPKSQALNERRKSVVAGGVASTVPVYVADADGGIIADVDGN
SFIDLGSGIAVTSVGASDANVVEAVREQVGHFTHTCFMVTPYESYIQVAEELNALTPGTH
EKRTVLFNSGAEAVENAVKVARLATGRDAIVAFDHAYHGRTNLTMALTAKAMPYKTNFGP
FAPEIYRVPMSYPYREEADIKGEEAAHRAITMIEKQIGADSVAAILIEPIQGEGGFIVPA
DGFLPTLAAWAKDNGVVFIADEVQSGFCRTGEWFATAHEGVVPDIITMAKGIAGGLPLSA
ITGRADLMDAVHPGGLGGTYGGNPIACAAALAAIKTMKEHDLNGRAANIERIVTARFEAL
VAEMGEAGIIGEIRGRGAMLAIELVQPGTANTTKEVNAEAAKAIAGACLAAGVIILTCGT
YGNVIRLLPPLVISDELLNDGLDVLSDAIRASA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatccagtaccgccttgcccaaaaacgccaaattctcggagcattccccggc
cccaagtcgcaggcacttaacgaacgccgcaagtcggttgtggccggcggggttgcctcc
accgttcccgtttatgtagcggacgccgacggcggcatcatcgccgacgttgacggcaac
tccttcatcgacctggggtccggcatcgccgtcacctccgtcggcgcctcggatgccaac
gtcgttgaggccgtccgcgagcaggtggggcacttcacccacacctgtttcatggtcacc
ccgtacgaaagctacatccaggttgccgaagagctcaacgccctgacccccggcacccac
gagaagcgcaccgtgctgttcaactccggtgccgaggctgtggagaacgccgtcaaggtg
gcccgcctggccaccgggcgcgacgccatcgtcgccttcgaccacgcctaccacggccgc
accaacctgaccatggcgctgaccgccaaggcgatgccgtacaagacgaacttcggcccg
ttcgcaccggagatctaccgcgtgcccatgagctacccctaccgcgaggaagcagacatt
aagggtgaagaggcggcacaccgcgccatcaccatgatcgagaagcagattggcgccgac
tccgtcgccgcaatcctgatcgagcccatccagggtgagggcggcttcattgtcccggcc
gacggcttcctgcccaccctggctgcctgggccaaggacaacggtgtcgtcttcatcgcc
gacgaggtccagtcaggtttctgccgcaccggcgaatggttcgccaccgcgcacgagggc
gttgtcccggacattatcacgatggccaagggcatcgccggcggcctgccgctttcggcc
atcacgggccgcgcggacctcatggatgccgtgcaccccggcggcctcggcggcacctac
ggcggaaacccgatcgcctgcgccgcagcactcgctgccatcaagacgatgaaggagcac
gacctcaacggccgtgccgcaaacatcgaacgcatcgtcaccgcacgcttcgaggcgctc
gttgcggagatgggcgaggccggcatcatcggcgaaatccgcggccgcggcgccatgctg
gcgatcgaactggtccagccgggcactgccaacaccaccaaggaagtcaacgcggaggcc
gccaaggccatcgccggcgcctgcctggccgccggtgtcatcatcctgacctgtggcacc
tacggcaacgtcatccgcctgctcccgccgctggtcatcagcgacgaactactcaacgat
ggcctggatgtcctctccgacgcgatccgcgcctccgcctaa

DBGET integrated database retrieval system