KEGG   Arthrobacter sp. YN: CGK93_03980Help
Entry
CGK93_03980       CDS       T05171                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arn  Arthrobacter sp. YN
Pathway
arn00620  Pyruvate metabolism
arn00680  Methane metabolism
arn01100  Metabolic pathways
arn01120  Microbial metabolism in diverse environments
arn01200  Carbon metabolism
Module
arn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:arn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGK93_03980
  Energy metabolism
   00680 Methane metabolism
    CGK93_03980
Enzymes [BR:arn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CGK93_03980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Se-cys_synth_N DUF885
Motif
Other DBs
NCBI-ProteinID: ASN18948
UniProt: A0A221NGM4
LinkDB All DBs
Position
839593..842391
Genome map
AA seq 932 aa AA seqDB search
MVHTAPQDTDLAAELRADVRRVSTLLGESLVRQHGPELLALVEQVRLLTKESKEAARGGA
DATGPWSAHDVVAQVRELLASLPLDQATDLVRAFAFYFHLTNAAEQVHRVRGLRTRQEKD
GWLAKAVSEIAGQAGPQVLQDVINELDVRPIFTAHPTEASRRSVLDKVRKLSDVLAEPTA
EGTSARRRQDRQLAEIIDQMWQTDELRQVRPTPVDEARNAIYYLNSILTDAMPEMLTDLS
ELLAEHGVALPVAAAPLRFGSWIGGDRDGNPNVTAAVTREILQLQNQNAVRISIALIDEL
ISVLSNSTALFGADQVLLDSIAEDLKNLPGLDKRILELNAQEPYRLKLTCIKAKLINTGR
RVSASTYHEPGRDYATTSELLAEFGLLEDSLRNHSAALVADGALARVRRAIAAFGLHLAT
LDIREHADYHHDAVGQLVDRLGTEKPYGELSREERFTFLGAELASHRPLSGHPIKLEGTA
DGTYDVFRSIRQALHTYGPDVVETYIISMTRGADDVLAAAVLAREAGLIDLFGAKPHAKI
GFAPLLETVEELRASAEIVDQLLSDPSYRELVRLRGDVQEVMLGYSDSNKESGVMTSQWE
IHKTQRKLRDVAAKHGVRVRLFHGRGGSVGRGGGPTYDAIMAQPNGVLEGEIKFTEQGEV
ISDKYSLPELARENLELSLAAVMQGSALHRTPRTSEDERERYANVMETISDAAFDRYRTL
IDDPELPAYFLASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVPGW
FGVGSGLKAAREAGNTDQLLEMMDRWHFFRSVISNVEMTLAKTDMEIAGHYVSSLVPEEL
HRLFHMIRDEYELTVAEIERLTGEIELLDAQPTLKRSLEIRDQYLDPISYLQVELLRRVR
EESVSGTEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggttcacactgcccctcaagacaccgatctcgctgcagaattgcgcgccgacgtgcgc
cgcgtttccacgctcctgggtgaatcgttggttcgccagcacggtccggaattgcttgcc
ctggtggagcaggtccgcctgctgaccaaggagtccaaggaagccgcgcgcggcggtgct
gatgccaccgggccttggagcgcgcacgacgtcgttgcccaggtccgcgagttactcgcc
tccctgccgctggaccaggcgacggatctggtgagggcctttgcgttctacttccacctc
accaatgcggcggaacaggtccatcgtgtccgtggcctccgcacccggcaggaaaaggat
ggctggttggccaaagccgtttccgagatagccggccaagcgggtccccaggtcttgcag
gacgtgatcaacgaactcgacgtccgccccattttcacggcgcaccccacggaagcttca
cgccgttccgtgttggacaaggtccgtaaactctccgatgtccttgccgagcccacggcg
gaaggcacgtccgcgcgtcgtcgacaggaccggcagcttgcagaaatcatcgatcagatg
tggcagaccgatgagttgcgccaggtccgccccacgcccgtggatgaggcacgaaacgcc
atctactacttgaacagcatcctgaccgacgccatgccggaaatgctgacggacttgtct
gagcttctggccgagcacggtgtcgcgcttccggtggccgccgcgccgctgcggtttggt
tcgtggatcggtggtgaccgtgacggcaaccccaacgtcacagctgctgtcacccgggag
atcctgcagctgcagaaccagaacgccgtgcgcatcagcattgccttgatcgacgaactc
atttcggtgctgtccaactccacggcactttttggggccgaccaggtactgctggactcg
atcgccgaagacctcaagaacctcccggggctggacaagcgcatccttgaactgaacgct
caagagccctacaggctcaagctgacatgcatcaaggccaagctcatcaacacgggacgc
cgcgtttcggcgtcgacgtatcacgagccaggccgcgactacgccaccacctcagagctg
ctggcagaattcgggctgttggaggactcactgcggaaccactcagccgcgctggtggca
gatggtgctctggcccgtgttcgccgggcaatcgcagccttcggcctgcatttggcaacg
ctggatatccgcgagcacgccgattaccaccacgacgctgttggccagcttgtggaccga
ctcggcacggagaagccgtacggcgagctcagccgtgaggagcgctttacgttcctgggc
gcagaactggcctcccaccgcccgctctccgggcaccccatcaagctggagggtactgcc
gacggcacgtatgacgtcttccggagcatccggcaggcgcttcacacctatgggccggac
gtagtggagacgtacatcatctcgatgacccggggcgctgatgatgtccttgccgctgcc
gtcctggcccgtgaagctggactgattgaccttttcggggccaagcctcacgccaagatc
gggtttgccccgctgctggaaaccgtggaagaactgcgcgcttctgccgagatcgtggac
cagttgctgtccgatccgtcctaccgggaactcgtccgtctccgcggcgatgtccaagag
gtcatgctgggctactccgattccaacaaggaatccggagtgatgaccagccagtgggaa
atccataaaacccagcgcaaactgcgcgatgtagccgccaaacacggcgtgcgcgtccgc
ttgttccatggccgtggtggttccgtgggccgcggcggcggaccgacatacgacgccatc
atggcgcagccgaacggcgtccttgaaggtgagatcaagttcaccgagcaaggtgaggtc
atttcggacaaatactccctgcccgaactggcacgcgaaaaccttgagttgtcccttgct
gcggtgatgcagggctcggctctgcaccggactccgcgtacttcggaggacgagcgcgag
cgctacgcgaacgtcatggaaaccatctccgacgcagcattcgaccgttaccgcaccctg
atcgacgatcccgagttgccggcctacttcctcgcctccaccccggtggagcagttgggt
tcgctgaacatcggatcgcgcccgtccaagcgtccggattccggcgcaggcctcgggggt
ctccgggctatcccatgggtcttcggttggacccagtcccggcagatcgttccggggtgg
tttggtgtgggttcaggcctgaaggctgcccgcgaggcaggcaacaccgaccagctcctg
gagatgatggaccgctggcacttcttccgctcggtcatctccaacgtggagatgacgctt
gcaaagactgacatggaaattgccggtcactacgtttcgtcgctggtcccggaggaactt
caccgcctgttccacatgatccgtgacgaatacgagctcaccgtggccgaaattgagcgg
cttacaggcgagatcgagctcctcgatgcccagcccacgctcaaacgttccctggaaatc
cgcgatcagtacctggatcccatcagttaccttcaggtggagctgctccgccgcgtgcgc
gaagagtccgtgtccggaaccgagatcgacgaacggctgcagcgggccatgctcatcacg
gtcaacggtgtggccgcgggcctgcgcaacaccggctaa

DBGET integrated database retrieval system