KEGG   Arthrobacter sp. YN: CGK93_21540Help
Entry
CGK93_21540       CDS       T05171                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
arn  Arthrobacter sp. YN
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ASN21958
UniProt: A0A221NQ77
LinkDB All DBs
Position
complement(4692834..4693898)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVSPMLAKSVPTIPDVGHYEPKWDGFRTIVFKDGDEIILGSRNEKPMTRYFPE
LVEALRKNLPDKCVIDGEIVLIEGNRLEFEVLQQRIHPADSRVRMLAEKTPASMIAFDIL
ALGDDDLMGTPFSERRAILERALAKAEPPVYVTPAVTDLERAKEWFVQLEGAGLDGVLSK
PLDGTYLPNKRVMFKTKHERTADCVVAGFRWHKTAKVVGSMLLGLYSDAGRLQHVGVVAS
FPMARRESLVAELEPYQVELGKHPWGEWASQGEGAGGSRMPGAQSRWGAGKDFSFVPLRP
ELVIEVAYDYMEGERFRHTTQFRRWRPDRTPESCTYSQLEEPADYDLGEILRLP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcctgtgatgccacccgtctcgcccatgctcgccaaatccgtccccaccatc
cccgatgttgggcattacgagcccaaatgggacggcttccggaccattgtcttcaaagat
ggcgatgagatcatcctgggcagccgcaacgagaaacccatgacccgctacttccctgaa
ctggtggaggcgctgcggaagaaccttccggacaaatgcgtgatcgacggcgagattgtc
ctgatcgagggcaaccggctggagttcgaggtgctgcagcagcggatccacccggccgac
agccgggtccggatgctcgccgagaagactccggcgtccatgatcgcgttcgatatcctg
gccctcggcgacgacgacctgatgggcactcctttttcggagcgtcgggccatcctggaa
cgtgcgctcgccaaggcggagccgcccgtttacgtcacccccgcagtcacggaccttgaa
cgtgcaaaggaatggttcgtgcagttggaaggcgcaggcctggacggtgtgctgtccaag
cccttggatgggacgtatttacccaacaagcgcgtgatgttcaagaccaagcacgagcgc
accgcggactgcgtggtggccggcttccgctggcacaagacagcgaaagttgtggggtcc
atgctgttgggtctttatagcgacgccggccggctccagcatgtgggggtggtggcctca
ttccccatggccagaagggaaagcctggtagctgagctcgagccgtaccaggtggaactc
ggcaagcatccctggggcgagtgggccagtcaaggggaaggggccgggggttccaggatg
cccggggcccaaagccggtggggcgcgggcaaggacttctcgtttgtgcccctgcgtccc
gaactggtgatcgaggtggcctacgactacatggagggcgagcggttccggcacaccacg
cagttcaggcgctggcggccggaccgcacgccggagagctgcacttactcccagttggaa
gaacccgcagattacgatcttggggagatcctgaggctgccgtag

DBGET integrated database retrieval system