KEGG   Arthrobacter sp. QXT-31: BWQ92_10755Help
Entry
BWQ92_10755       CDS       T05056                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
arq  Arthrobacter sp. QXT-31
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2373727..2374794
Genome map
AA seq 355 aa AA seqDB search
MQLPVMPPVAPMLAKSVGAIPEGRLSYEPKWDGFRSIIFRDGDDVEIGSRNEKPMTRYFP
ELVEALKANLPPKCVIDGEIVLVGASGDRLDFDALQQRIHPAASRVKLLSEQTPAKFVAF
DLLALGDEDFSGRPFAERRAALEKAFAAASAPVHLTAATQDPELAGKWFHQFEGAGLDGI
VAKPLDGPYQPDKRVMFKIKHERTADCVLAGYRVHKSGPDAIGSLLLGLYKPDGELASVG
VVGAFPMKRRRELFEELQPLVTGFDEHPWAWAKQEEGARTPRNAEGSRWSAGKDLSFTPL
RPERVLEVKYDHMEGERFRHTAQFVRWRTDRDPESCTYEQLEEPVKFDLAEVLAT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgccggtcatgccccctgtcgcccccatgctggccaaatcggtcggcgccatc
cctgaaggccgcctgagttacgagccgaagtgggacggattccgctccatcatcttccgt
gacggcgacgacgtggagatcggcagccgtaacgagaagccgatgacgcgctacttcccg
gagcttgtggaggcgctgaaagccaacctgccgccgaagtgcgtgatcgacggggagatc
gtcctggtgggtgcttccggggaccggctggactttgacgccctgcagcagcggatccac
ccggcggccagcagggtcaagctgctctccgaacagacgccggccaagttcgtggcgttc
gacctgctggcgctcggcgacgaggacttcagcggccgtccctttgccgaacggcgcgcg
gccctggagaaggccttcgccgccgccagcgccccggtccacctgactgctgccacccag
gacccggaactggccggaaagtggttccaccagttcgagggcgccggcctggacgggatc
gtggccaagccgctggacgggccgtaccagccggacaagcgggtgatgttcaagatcaag
cacgagcggaccgcagactgcgtgctggccggctaccgcgtgcacaagagcggccccgac
gccatcgggtcgctgctgctgggcctctacaaaccggacggggaacttgccagcgtcggc
gtcgtgggcgcctttccgatgaagcggcgcagggagcttttcgaggaactccagcccctg
gtgaccggcttcgatgagcacccctgggcgtgggccaagcaggaggagggggcccggaca
ccccgcaacgcggagggcagccggtggagtgcgggcaaggacctgtccttcacgccgctg
cggccggaacgggtgctggaagtgaaatacgaccacatggagggcgaacggttccgccac
acagcgcagttcgtgcgctggcggaccgaccgggacccggagtcctgcacttacgaacag
ctcgaggagccggtgaagttcgacctcgccgaggtgctcgccacctag

DBGET integrated database retrieval system