KEGG   Arthrobacter sp. FB24: Arth_0543Help
Entry
Arth_0543         CDS       T00421                                 

Definition
(GenBank) Exo-alpha-sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
art  Arthrobacter sp. FB24
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Arth_0543
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arth_0543
Enzymes [BR:art01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Arth_0543
Bacterial toxins [BR:art02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Arth_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
576730..579777
Genome map
AA seq 1015 aa AA seqDB search
MWDKSLCPTRFRTAALGRLPERTVDLKLKKREPAGRAGSVGRVAAAGLLGMALIAGPGLP
ARAEPAPPSNPAAAPGTFAEANIAADRTAANFFYRIPALTYLGNDVVLAAWDGRPGSSAD
APNPNSIVQRRSIDGGATWGPLTVIAAGHVADASGPKYGFSDPSYIYDAEANKVFALFVY
SKDAGFSASTYGNDDADRNVISSAVVESADEGRTWSQPRFITSVTKPGSSKTNPQPGDVR
TNFAASGEGIQLKYGAHKGRLIQQYSGYVRQANGSELFQAYSVYSDDHGATWHKGAPIGD
RMDENKTVELSDGRVLLNSRDSGNGGYRKVAVSTDGGASYGPVTQDTELPDPANNGSISR
MYPAAPEGSAEARKLIFTNSNSKAARENVSARVSCDDGATWPGVRTIRPGFSAYSTITRL
AEGKFGVLYEANYTDNIQFASFDDAWLNYVCAPVNVPAQTIAPGVAQQVPVTVTNQEAHV
LSGARASIYTPAGWSAATVDVPDLATGSSATVNVQLTPPAGASGPTSLNAAFTTADGRVS
QYTFVANSPVAPQVGLTIAGSAPARDVAANPYKEGEVLSYTFAVKSTSNVTSNAVPLSGT
FETGFLPPSAPNCRYNNLAAGASYNCTTPKHTLTPEDIARGYLVPVAEFTVTASGNTALT
KAVSFKGAAVPLRDGLLAGSISGARNDAGRDLAVQPYAAGEQVPYTFTVSNTGPLAADVV
PIAGNFSPLVPPGAGNCRWLNLAAGGSYACSTPRHTVTQKEAEEGFFRADSTWTVAASGQ
SSREYRVDGGEVDLAIRNPKLDGTISAEWADADGDRYASAGDSVTYTYGVGNAGNVALTG
VTATDAGISVDRLGIGETATATRVHILTPADIAAGQLPASPFAASASNGSRNVRVDVQAG
AVALRLQPAKPAAVPVLTVQDFDGQVPPVDLDTNEKYRNGEKVTLRGLPHGQWYYVYLNK
HGFRLGWIFPTTADTVEFLLPSTVQNGRDDVVVLDSEGKQVSFDRLQVTPKGSIG
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgtgggacaagtcgctatgcccgacacgttttcgcactgctgccctagggcggctacct
gaaaggacagtggatttgaaactcaaaaagagggagccggccggcagggccggctccgtg
ggccgggtggccgccgcagggctccttgggatggcgctgatcgcgggacccgggttgccg
gccagggccgagccggctccgccctccaatccggcagccgccccgggcaccttcgcggaa
gcgaacattgccgcggaccggacggccgccaatttcttttaccgtattcccgcgctcacc
tacctcgggaacgacgttgtacttgcagcgtgggacggcaggcccgggagctcggccgac
gcgccgaacccgaactcgatcgtgcagcgccgcagtatcgacggcggcgcaacgtggggt
cctttgaccgtcatcgctgccggccatgtggctgatgccagcggccccaaatacgggttc
agtgatccgtcgtacatctacgacgctgaggcgaacaaagtgttcgccctgttcgtttac
tcaaaggatgccggcttctctgccagcacctacggcaacgacgacgccgacaggaatgtc
atttcctcggccgtggtggagtccgccgacgaaggccgcacctggagccagccccggttc
atcacaagcgtcacgaaacccggaagcagtaagaccaacccgcagccgggtgacgtacgc
accaacttcgcggcatccggtgaggggatccagctcaagtacggcgctcacaaaggccgg
ttgattcagcagtactcgggttacgtgcgtcaagccaacggttcggaactcttccaggcc
tacagcgtctattcagatgaccatggcgcaacgtggcacaaaggggccccgatcggcgac
cgcatggacgagaacaagaccgtggaactctccgacggcagggtgctgctgaattcgagg
gacagcgggaacggcggctatcgcaaagtggccgtgtccaccgacggcggcgccagctac
gggccggttacgcaggacaccgaactgccggaccctgccaacaacgggtcaatctcccgg
atgtacccggccgcaccggagggctcagccgaggcaaggaagctgatcttcaccaattcc
aactccaaggccgccagggaaaacgtctcggcgcgggtgtcctgtgacgacggagcaacg
tggcccggtgtccgcaccatccgtcccggcttctccgcgtattcaaccattacccgcctg
gccgagggcaagttcggcgtcctgtacgaggcgaactacacggacaacatacagttcgcc
agtttcgacgacgcctggctgaactatgtctgcgctcccgtgaacgtgcccgcacaaacc
attgcgcccggtgttgcgcagcaggttccggtgacagttaccaaccaggaagcccacgtc
ctgtcgggcgcccgggccagtatctatacgccagcgggatggtccgccgccactgtggac
gttcctgaccttgcaacgggtagctcggccacggtgaacgtccagctcacaccgccggcc
ggagcttcgggtccaacttccctcaatgcggctttcaccactgccgacggaagagtgtcc
cagtacacgttcgttgccaacagtccggtagctccccaggttggcctgaccatcgcaggc
tcagcgccggcacgggacgtggcggcgaacccgtacaaggaaggcgaggtgctgtcttac
accttcgcggtcaagagcacgtcgaacgtcacgtccaatgccgtccccctttccgggacc
ttcgagaccgggttcctgccgccgtcggcccctaactgccggtacaacaaccttgccgcc
ggtgccagctacaactgcacgacgcctaagcacacgcttactcctgaagacatagcgcgc
ggctacctcgtccctgtggctgagttcaccgtcacggcctccggcaatacggcactgacg
aaggcagtgtccttcaaaggagcagccgtaccgttgcgggatggcctgctggccggatcg
atcagcggtgcccggaatgatgccggacgtgacctcgccgtgcagccgtatgcagccggc
gagcaggtgccctacacgtttaccgtcagcaacaccggccccctggccgcggacgttgtg
ccgattgccggcaatttctcacccctcgtacccccgggcgcgggaaactgccggtggctc
aaccttgccgcgggaggatcctacgcatgctccacaccgcggcacaccgtgacccaaaaa
gaggcggaggagggattcttccgtgccgactccacttggacagttgctgcgtccgggcag
agcagccgggaataccgtgtggacggcggcgaagtggacctcgcgatccggaacccgaag
ctggacggcacgatctcggctgaatgggccgatgccgacggcgaccgctacgcgagtgcc
ggggattccgtcacctacacctacggcgtgggaaatgccggcaatgtcgcgctgaccggc
gtcacggctacggatgccggcatttcagtggacaggctgggcatcggggagacagcaacg
gcaaccagggtgcacatcctgactcccgcagatatcgcggccggccagttgccggcctct
ccgtttgccgcctctgcatccaacgggtcgcggaacgtgcgcgttgacgtgcaggccgga
gcggtggccctgcggcttcagccagccaaaccggcggccgttccggtgttgacggtccag
gatttcgacgggcaggttccgcccgtcgacctggacaccaatgaaaaataccgtaacggc
gagaaggtgacgctccgcggccttccccacggccagtggtattacgtctacctgaacaag
cacggcttccgcctcggctggatctttcccaccacggcggacacggtggagttcctcctg
ccctccactgtgcagaacgggcgggacgacgtggtggtcctggattccgaagggaagcag
gtttcctttgaccgacttcaggtcacaccgaaagggtccatcggctga

DBGET integrated database retrieval system