KEGG   Arthrobacter sp. U41: ASPU41_01465Help
Entry
ASPU41_01465      CDS       T05053                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00010  Glycolysis / Gluconeogenesis
aru00071  Fatty acid degradation
aru00350  Tyrosine metabolism
aru00625  Chloroalkane and chloroalkene degradation
aru00626  Naphthalene degradation
aru01100  Metabolic pathways
aru01110  Biosynthesis of secondary metabolites
aru01120  Microbial metabolism in diverse environments
aru01130  Biosynthesis of antibiotics
aru01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASPU41_01465
  Lipid metabolism
   00071 Fatty acid degradation
    ASPU41_01465
  Amino acid metabolism
   00350 Tyrosine metabolism
    ASPU41_01465
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ASPU41_01465
   00626 Naphthalene degradation
    ASPU41_01465
Enzymes [BR:aru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ASPU41_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOT02210
UniProt: A0A1C9WM37
LinkDB All DBs
Position
complement(295780..296790)
Genome map
AA seq 336 aa AA seqDB search
MQAAVVTEFGKDLQIQTLPVPVPGRGEALVKVLTTGVCHTDLHAAEGDWPVKPTPPFIPG
HEGVGEVVALGEGVTDLAVGDLVGNAWLWSACGDCQYCRTGWETLCEAQQNAGYSVDGSF
GEYMLVDTRFAARIPAGSDPVEVAPVLCAGVTVYKGLKMTEARPGQWVTISGIGGLGHIA
VQYAVAMGLRVAAVDIADDKLALAKKHGAELTVNALHEDPAEVIQRETGGCHGVLVTAVH
PSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDLEEALDFYA
QGKIHPTVSTRELSDVNAVLDEMKHAKIDGRVVIKY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgcggtagtaaccgaattcggcaaggatctgcagatccagacgctccccgtg
ccagtgccgggacggggtgaggccctggtcaaggtcctgaccaccggcgtctgccacacc
gacctccacgccgcggaaggcgattggccggtcaagccgaccccgccgtttatccccggc
cacgaaggagtcggcgaggtggttgccctcggcgagggcgtcaccgacctggccgtcgga
gacctcgtcggcaatgcctggctctggtccgcctgcggtgattgccagtactgccgtacc
ggttgggaaaccctgtgcgaagcgcagcagaacgccggctacagcgttgacggttccttc
ggcgaatacatgctcgtggacacacgcttcgcggccaggatcccggccggctcggacccc
gtggaggtggccccggtgctctgcgccggagtgaccgtctacaagggactcaaaatgacc
gaggcccgccccggccagtgggtcacgatctctggcatcggcggactcggccacatcgcc
gtgcagtatgcggtggccatgggcctgcgggttgcagcggtggacatcgccgacgacaaa
ctcgcccttgccaaaaagcacggtgcggaactgaccgtcaatgccctgcacgaagatccc
gctgaagtcatccagcgcgaaaccggaggttgccatggagtcctggtcacggctgtgcac
ccgtcagcattcggccaggcgatcgggatggcccgccgcggcggaacgattgtgttcaac
ggcctgccgccgggcgactttccggcgccgatctttgagattgtgctcaagggcctgaca
gtccgcggctccatcgtcggaacccggcaggacctggaggaggccctggacttctatgcc
cagggcaagatccaccccaccgtctccacccgggagctctccgacgtcaacgccgtcctt
gacgaaatgaagcacgccaaaatcgacggccgcgtcgtcatcaagtactga

DBGET integrated database retrieval system