KEGG   Arthrobacter sp. U41: ASPU41_05340Help
Entry
ASPU41_05340      CDS       T05053                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
aru  Arthrobacter sp. U41
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1137254..1138330)
Genome map
AA seq 358 aa AA seqDB search
MRLPLMPPIAPMLAKSVSALPDGPLMFEPKWDGFRSIIFRDGEDVEIGSRNGKPLTRYFP
ELVEALKANLPPRCVLDGEIIMIGASGDRLDFDTLQQRIHPAASRVRLLAEQTPARFVAF
DLLALDDEDLTARPFAERRAALERVLAGSAAPIHLTAATRDKGTAEEWFHQFEGAGLDGV
VAKPLDGQYLPDKRTMFKIKHERTADCVLAGYRVHTSGPDRIGSLLLGLYGDDGGLANVG
VVGAFPMQRRKELFEELQPLVTGFDEHPWAWDRQEDGTRTPRNAEGSRWSGGKDLSFTPL
RPERVVEVKYDHMEGERFRHTAQFVRWRPDRDPRSCTYEQLEEPVRFDLAEVLGARQD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgccgctgatgcccccgatcgcgcccatgctggcgaagtccgtaagtgccctg
cctgacggcccgctgatgttcgaaccgaagtgggacgggttccggtccatcatcttccgc
gacggcgaggacgtggagatcggcagccggaacggaaagcccctcacccgctacttcccc
gaactcgtcgaggcgctgaaggccaacctgccgccgcgctgcgtgctcgacggtgaaatc
atcatgatcggtgcctccggcgaccggctcgattttgacaccctgcagcaacggatccat
cccgcggcaagccgggttcggctgctggccgaacagacgccggcgagatttgtcgcgttc
gacctgctggccctcgacgacgaggacctcaccgcgcgccccttcgccgaacggcgcgcg
gcgctggaacgcgtgctggccgggagtgcggcgccgatccacctcaccgccgcgacccgg
gacaagggaaccgccgaggagtggttccaccagttcgagggggccggcctcgatggggtc
gtggccaaaccgctggacgggcagtacctgccggacaagcgcaccatgttcaagatcaag
cacgaacgcaccgcagactgcgtcctcgccgggtaccgcgtccacacctccgggccggac
cggatcggctcgctgctgctggggctctacggcgacgacggcggactcgccaatgtcggt
gtggtcggggccttcccgatgcaacgccggaaggaactcttcgaggaactccagccgctc
gtgaccggcttcgacgagcacccctgggcctgggaccggcaggaggacgggacccggacg
ccgcgcaatgccgaaggcagccggtggagcggaggcaaggacctctccttcaccccgctc
cgcccggagcgggtggtggaagtgaaatacgaccacatggaaggcgaacggttccgccac
acggcgcagttcgtccgctggcgcccggaccgggacccgcggtcctgcacctacgaacag
cttgaggaaccggtcaggttcgatctggcagaggtgctgggcgcccgccaggactga

DBGET integrated database retrieval system