KEGG   Arthrobacter sp. A3: MB46_13155Help
Entry
MB46_13155        CDS       T04228                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
arw  Arthrobacter sp. A3
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MB46_13155
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MB46_13155
Enzymes [BR:arw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MB46_13155
Peptidoglycan biosynthesis and degradation proteins [BR:arw01011]
 Precursor biosynthesis
  Racemase
   MB46_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2954034..2955230)
Genome map
AA seq 398 aa AA seqDB search
MVSPFVVPVPAPSHGLERQAIIDLSAIANNIRHLREIAAPAKFMAVVKADAYGHGMIQVA
STAVAAGAQWLGTAHVSEGLALRTAGFEVPVLSWLHTPDTDFTAAVANEIDLGCSDWELE
HIVAAARELQRPARIHLKIDTGLGRNGCSRENWSALAEAAMSYEHQGLLRVVGVFSHLAV
ADEPDRPETDRQLERFREAIGVLEAAGAHLEVRHIANTPATLSRPDSHFDMVRVGLGLYG
LSPFEDRTSAQLGLVPAMTLQTQIALCKDVPTGQGVSYGLNFISEVPTTLGLVPVGYADG
IPRIATGGPVRVNGVTYPVVGRIAMDQMVIDLGPNAHEGFAPAVVPGSALGATAVLFGNG
ADGGPLVEQWAAAAGTVNYEIVTRISQRVPRRYVGGAQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ctggtgagccctttcgttgtgccagttccagccccgagtcacggtcttgaacggcaagcc
atcattgacctgtccgcaatcgccaacaacatccgtcatctgcgtgagattgccgcaccg
gctaaattcatggcggtggtcaaggccgacgcctatgggcacggcatgattcaggtggcc
agcacggcggtggcggccggggcgcagtggctgggaacggcccacgtctccgaaggcctc
gctctgcgtacagcggggtttgaggttccggtgttgtcctggctgcacacgccagacacc
gattttacggctgccgtggccaatgagattgacctgggatgttccgattgggaactcgag
cacattgttgccgcggcccgtgaactccagcggccggcccggatccacctcaaaattgat
accgggttgggccgtaacggctgttcccgggaaaattggtccgcccttgccgaggcggcc
atgagctacgagcatcaggggctgttgcgcgtggttggcgtctttagccacctggctgtg
gcggatgaacctgatcgcccggaaacggatcggcagctggaacggttccgcgaggccatt
ggggttcttgaggcggccggggcccaccttgaggtccggcacattgccaataccccggcc
acgctgtcccgccccgattcccattttgatatggtccgggtggggctggggctgtatggg
ctttcgccgtttgaggatcgcacctccgcccagctggggttggttccggccatgaccctg
cagactcagattgcgctgtgcaaggatgtccccacaggccaaggggtctcctacggactc
aattttatttccgaggtgcccaccaccttgggccttgtcccggtggggtacgcggacggc
attccgcgcatcgccacgggtggtccggtccgtgtcaacggagtcacataccccgtggtg
gggcgcatcgccatggaccagatggttattgacctaggacccaatgcccacgaaggcttt
gctccggcagtagttccgggttccgcattgggtgccaccgcggtgctttttggcaacggg
gccgacggtggacctctcgttgagcagtgggcggcggctgccggaaccgtcaactatgag
atcgtgacgcgcataagccagcgagtgccgcgccggtatgtgggtggtgcccagtga

DBGET integrated database retrieval system