KEGG   Aerococcus sanguinicola: AWM72_03790Help
Entry
AWM72_03790       CDS       T04253                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
asan  Aerococcus sanguinicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AWM72_03790
Enzymes [BR:asan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AWM72_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
851858..853303
Genome map
AA seq 481 aa AA seqDB search
MNGTMIQYFEWELADDGKHWQRVAKDAQHLADKGFSHIWLPPATKGTGTNDVGYGVYDLY
DLGEFDQKGSQRTKYGTKDEYMKAIQALQEAGISVLGDVVLNHKAGADESERFEAYEVNP
DNRQEIISDAHEIEGWTKFTFPGRGDTYSAFKWNWTHFSGVDYDQATDSKGIFMIKGLNK
GWADNDEVDNEKGNFDYLMFADIDYRHPDVVKEVENWAKWYVQETGLNGFRLDALKHINA
DFIEELAAKLLEADPDFYLIGEYWKGDYASLENYMNETSFDIDLFDVKLHQNFKAASEAV
DGFDMSSLLDDTLLQKNPTLAIPFVDNHDSQPGQSLESWVQDWFKPLAYALILLHQDGLP
CVFYGDYYGIGGDKPIPGKQELLDKLLDLRQKQAYGKQNNYFDHPNCVGFTREGDDDHPD
GLALLMSNGEAGFKDMYVGQAHAGQEWQDALGKSQDTITINDDGYGHFTCPAGGVSVWTR
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaacgatgattcagtattttgagtgggagcttgcggatgatggcaagcactgg
cagcgggtggcaaaagacgcccaacaccttgctgacaagggcttttcccatatttggctg
cccccagcgaccaagggaacgggcaccaatgacgtgggctatggggtttatgacctctat
gacctgggcgagttcgaccaaaaagggtcccagcgcaccaagtatgggaccaaggacgag
tatatgaaggccatccaagccctgcaagaagcgggcatctccgtcctcggcgatgtcgtg
ctcaaccacaaggccggggcggatgagtctgagcgattcgaagcctatgaagtgaacccg
gacaaccgccaggagatcatttccgacgcccatgagatcgaaggctggaccaagtttacc
ttccctgggcgcggggatacttatagcgctttcaagtggaattggacccatttttccggt
gtcgactatgaccaggcaaccgacagcaagggaatttttatgattaaggggcttaacaag
ggctgggcggataatgatgaggtggataatgagaaggggaactttgactacctgatgttc
gccgatatcgactaccgccatcccgatgtggtcaaagaagtggaaaattgggccaagtgg
tatgtccaagagaccggcctgaacggcttccgactcgatgccctcaaacatatcaacgcc
gacttcatcgaagaactggcggccaagcttctggaagctgatcctgacttctacctgatc
ggggaatactggaagggggactacgccagcctggaaaattatatgaacgaaaccagcttc
gacatcgacctcttcgacgtcaagctccaccaaaacttcaaggcggcttccgaagcggtg
gatggcttcgacatgtccagcctgctcgacgataccctactccagaagaacccaaccctg
gccatccccttcgttgacaaccatgactcccaacctggccaatctctggaatcctgggtc
caagactggttcaaacccctcgcctacgcccttatcctcctccaccaagacggcctgccc
tgcgtcttctacggcgactactacggcattggcggtgacaagcccatccctggcaaacaa
gagctcctcgacaaactcctggacctcagacaaaaacaagcttacggcaagcaaaacaac
tacttcgaccaccccaactgcgtcggcttcacacgcgaaggcgacgacgaccaccccgac
ggcctcgccctcctcatgtccaacggcgaagccggcttcaaagacatgtacgtcggccaa
gcccacgctggccaagaatggcaagacgccctcggcaagagccaagacaccatcaccatc
aacgacgacggctacggccacttcacctgcccagcaggaggagtctctgtgtggacaagg
gtgtga

DBGET integrated database retrieval system