KEGG   Amycolicicoccus subflavus: AS9A_1420Help
Entry
AS9A_1420         CDS       T01514                                 

Gene name
katE
Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
asd  Amycolicicoccus subflavus
Pathway
asd00380  Tryptophan metabolism
asd00630  Glyoxylate and dicarboxylate metabolism
asd01110  Biosynthesis of secondary metabolites
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AS9A_1420 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    AS9A_1420 (katE)
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     AS9A_1420 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AEF39872
UniProt: F6EH35
LinkDB All DBs
Position
complement(1476128..1478257)
Genome map
AA seq 709 aa AA seqDB search
MERRDSKDRSLDAARTNDDNSWLTTQQGVRVEHTDDSLKAGVRGPTLLEDFHAREKITHF
DHERIPERVVHARGAGAYGYFKAYDTRLRDYTAAEFLTEPKLTTPVFVRFSTVAGSRGSA
DTVRDVRGFATKFYTKQGNYDLVANNMPVFFIQDGVKFPDFVHAVKPEPASEIPQAQSAH
DTFWDFVWLHPESLHMVMWLMSDRALPRSYRMMQGFGVHTFRLVDFEGNGTFVKFHWRPI
LGSHSLEWAECQRIAGADPDYNRRDLWDAIEAGQFPEFELGVQLISELREHDFDFDLLDP
TKIVPEEQVPVQPVGRMVLNRNPQNFFAETEQVAFHTANVVPGIDFTNDPLLQARNFSYL
DTQLIRLGGPNFSQLPINRPVVEVHTNQRDGYGQHTIHTHPTSYTKNSLGNGCPMSMTQQ
EPPLDVYRHYTQRVEGEVIRRRSESFNDHYSQARLFWNSMKEVEQQHIRDAFCFELSKVS
SKYVRQRVTEQIAHVDPGLAMGVARKVGVPEPEDFGAALHNDASSALSQVYPVAGFDDAP
PSIESRRIAALVCDGVDDTGIRKLASALSAEGALLDLIGPAEGAIRGESGHSVDVSVGLS
STASVLYDAVIVPGGDIAALIETNGSAKHFLLEAFKHHKAVAAFGAGVEVLRRNGLTDAE
TSPVLVADEEGVIVTSHSGQELPDEFIRSFIDAVALHRIWNRETSHITA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggagcgccgtgacagcaaagaccgcagtctcgacgccgcgagaaccaacgacgacaac
tcatggctcacaacgcagcaaggggttcgggtcgagcacacggacgattcgctcaaggct
ggggttcgcggaccgacgctgctggaagacttccacgcgcgcgagaagatcacccacttc
gaccacgaacgaattcctgaacgagtcgtccatgcccgcggcgcaggtgcctatggctat
ttcaaggcctacgacactcggttgcgcgactatacggccgccgagttcctgaccgagccg
aagctgactacgccggttttcgtgcggttttccaccgttgcaggttcacgcggctccgcg
gacaccgtgcgcgatgttcgcggcttcgccacgaagttttacacgaagcagggcaactac
gacctcgtcgccaacaacatgccggtgttctttatccaagatggcgtcaagttccccgac
ttcgtccacgccgtcaaaccagaacccgcaagcgaaatcccccaggcccagtccgcgcac
gacactttctgggacttcgtgtggctccacccagaatcgctgcacatggtcatgtggctg
atgtcggaccgtgcgctcccccgcagttaccggatgatgcagggcttcggtgtgcacacc
ttccgcctggttgatttcgaggggaacggcacgttcgtcaagttccactggcggcccatc
ctgggttcgcactccctcgagtgggcggagtgccagcgcatcgcaggcgctgaccctgac
tacaaccgccgcgacctctgggacgcgatcgaagcagggcagtttcctgagttcgaactc
ggcgtccaactcatcagtgaattgcgcgaacacgacttcgatttcgatctactcgacccc
accaaaatcgtcccggaggaacaggttccggtacagcctgtcgggcgaatggtcctgaac
cgcaatccacagaacttcttcgccgaaacggaacaggtcgccttccataccgccaacgta
gtcccgggtattgacttcaccaacgatccgctcctgcaggcacgcaatttcagctacctg
gacacgcaactgatccgcttaggcggaccgaacttctcccagctgccgataaaccggccg
gtcgtcgaggtgcatacaaaccagcgagacggctacgggcagcacacgattcacacacat
cccacgagttacaccaaaaacagcctcgggaacggatgcccgatgtccatgacccaacag
gagccacccctcgacgtctaccgccactacacacagagggtggaaggcgaagtgatccgc
cgccggtcagagagcttcaatgaccattacagccaggcgcgactgttctggaacagcatg
aaggaggtcgagcaacagcacattcgtgacgctttctgcttcgaactctcgaaagtgtcg
tcaaagtacgtgcggcagagagtcactgaacagatcgcgcatgtcgacccgggcctcgct
atgggagtcgcgcgaaaagtcggcgtaccagagcctgaagacttcggggcggccctccac
aacgacgcatcgtcggccctcagccaggtctatccggtagcggggttcgacgacgcaccc
ccatcgattgagtcgcgccgaatcgctgctctggtctgcgacggcgtcgatgacacgggt
attcgaaaacttgctagcgcactctcagccgaaggggcgctactcgacctgattggacca
gccgagggcgccatccgcggcgagagtgggcattccgtcgacgtatcggtgggactgtcg
tctacagcgtcggtgctgtacgacgcagtcatcgttccgggcggtgacatcgccgccctc
attgaaaccaacgggtcggccaagcattttttgctcgaagcattcaaacaccacaaagcg
gtcgccgcgtttggcgccggtgtagaggtgctgcggcggaacggtctcactgatgccgaa
accagccctgtgctggtggccgatgaggaaggagttattgtcacgagccattctgggcaa
gaactgcccgacgaattcatccgcagtttcatcgatgcagttgcactgcatcgcatctgg
aaccgcgagacaagccacatcaccgcgtaa

DBGET integrated database retrieval system