KEGG   Amycolicicoccus subflavus: AS9A_2484Help
Entry
AS9A_2484         CDS       T01514                                 

Definition
(GenBank) Putative glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
asd  Amycolicicoccus subflavus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AS9A_2484
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS9A_2484
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS9A_2484
   00430 Taurine and hypotaurine metabolism
    AS9A_2484
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AS9A_2484
Enzymes [BR:asd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AS9A_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2541809..2543281)
Genome map
AA seq 490 aa AA seqDB search
MAGLKCRGKFLRHSARIFRLVYAPDMPLSQPSGGHHSHRRSVSVNPIFTREPLEIPHDRF
PRDQLDPDTAYQIVHDELMLDGNARLNLATFVSTWMEPQARTLMAECFDKNMIDKDEYPG
TAELEQRCVRMLANLWHAPPADAPTGCSTTGSSEACMLAGLALKRRWQQAGGEKRGRPNL
VMGVNVQICWDKFATYWDVEPRLVPMEGDRYHLTADEAVKYCDENTIGVVAILGSTYDGS
YEPVADICRALDDLQSRTGWNIPVHVDGASGAMIAPFCDPDLEWDFRLDRVASINTSGHK
YGLVYPGVGWVVWRDAEALPDELVFRVNYLGGEMPTFALNFSRPGAHVAAQYYNFIRLGF
DGYRRVQRTCRDVAMHLSSAIAELGPFELVTDGSELPVFAFTVRNDVTGYSAFDVSAALR
ESGWLVPAYTFPANREDLAALRVVVRNGFSHDLAERFLDEVKRVLPRLHRQDSPQRGSEA
ASFSHSAKRT
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcctgaaatgtcgcggcaagtttttgcgacactccgcgagaatcttccggctg
gtctacgctcccgatatgcccctgtcacagccttccggcgggcaccactctcaccggcgt
agcgtcagcgtcaaccccatcttcacgcgagaaccactcgagatcccgcacgatcggttt
ccccgtgaccagcttgatcctgataccgcgtaccagatcgttcacgacgaactgatgctt
gacggtaatgcccgtctcaacctcgcgacgttcgtgtcgacatggatggaaccgcaggcc
aggacgctcatggccgaatgtttcgacaagaacatgatcgacaaggacgagtacccgggc
acagccgaactcgaacaacgatgcgtgcgcatgctcgcgaacttgtggcacgccccgcca
gctgacgcgccaacaggctgctcgacaactgggtccagtgaggcatgcatgctggctggc
cttgcgcttaaacggaggtggcagcaagcaggcggagaaaagcgcggccgacccaatctg
gttatgggcgtcaacgtccagatttgctgggacaagttcgccacctactgggacgttgaa
ccgcggctcgtgccgatggagggtgacaggtaccacctcaccgcggacgaagctgtgaag
tactgcgacgagaacaccatcggcgtcgttgcaatcctcggctcgacgtacgacgggagt
tatgaacccgtcgccgacatctgtcgtgcgctcgacgacctgcaatcccgcaccggctgg
aacattcccgttcacgtcgacggcgcttcgggcgccatgatcgcacccttctgcgatcca
gacctggagtgggacttccgcctcgaccgcgtcgcatcgatcaacacctcgggacacaag
tacggtctcgtttatccgggtgtcggatgggtggtgtggcgggatgcggaagcattaccc
gatgagctcgtgttccgggtgaactacctgggcggtgagatgcccaccttcgcgctgaat
ttctcacggccgggagctcatgttgccgcgcagtactacaacttcattcgcctcgggttc
gacggatatcggcgggtccagcgcacctgccgggacgtggcgatgcacctctccagtgcc
atcgccgaacttggtccctttgaacttgtcaccgatggcagcgagctgccagtgttcgcc
ttcacggtgcgcaacgacgtcactggctattcggcgtttgatgtgtccgcggcgctgcgt
gaatcaggctggctcgtacctgcttacaccttccccgccaatcgggaggatctcgccgca
ttgcgcgtcgtcgtgcgaaacggattcagccacgacctcgctgagcgtttcctcgacgaa
gtcaagcgtgtgctgccgagattgcaccgacaggacagtccgcaacgcggcagcgaagcg
gcatctttctcgcacagcgcgaagcggacgtag

DBGET integrated database retrieval system