KEGG   Hoyosella subflava: AS9A_3606Help
Entry
AS9A_3606         CDS       T01514                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
asd  Hoyosella subflava
Pathway
asd00250  Alanine, aspartate and glutamate metabolism
asd00410  beta-Alanine metabolism
asd00640  Propanoate metabolism
asd00650  Butanoate metabolism
asd01100  Metabolic pathways
asd01120  Microbial metabolism in diverse environments
Module
asd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AS9A_3606 (gabT2)
   00650 Butanoate metabolism
    AS9A_3606 (gabT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS9A_3606 (gabT2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS9A_3606 (gabT2)
Enzymes [BR:asd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AS9A_3606 (gabT2)
Amino acid related enzymes [BR:asd01007]
 Aminotransferase (transaminase)
  Class III
   AS9A_3606 (gabT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEF42044
UniProt: F6ES40
LinkDB All DBs
Position
complement(3675704..3676945)
Genome map
AA seq 413 aa AA seqDB search
MTRISPLLKQATPVTVDHGEGCYLYGTDGRRYLDFTAGIGVTSTGHCHPRVVEAARAQVG
SLIHGQYTTVMHKPMLELVEKLGEVLPEGLDSLFFSNSGSEAVEAALRLARQATGRPNVI
VFHGGFHGRTVAAASMTTSGTRFSAGFSPLMAGVHVAPFPTAFRWGWSEEEATDFALREL
DYLFATISSPKETAAFIVEPVLGEGGYVPGNTRFFQGLRERADQHGIVLILDEIQTGFGR
TGKFFGHQHFDIKPDVITIAKGLASGFPLSGIAAPEALMAKAWPGSQGGTYGGNAVACAA
AVATIDVIRDEGLVDNAAQRGTQLLHGAANLATKAIGDTRGLGLLVGSEFVDENGKPDGT
KAAAAQQLAGKKGLLLLMCGAYMNTVRMIPPLIVTSEQIDEGLSIWEEVLAEI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgacacggatatctccactcctcaagcaagcgaccccggtcaccgtcgatcacggcgag
ggctgctacctatacggcaccgacggacggcgatacctcgacttcaccgcgggtatcgga
gtcacgagtaccggacactgccacccacgcgtcgtcgaggccgcgcgcgcccaggtcgga
tcgctgatccacgggcaatatacgaccgtcatgcacaagcccatgctggagctagtcgaa
aagctcggcgaggtgcttcctgaggggctcgattcgctgttcttctcgaactcgggaagt
gaagctgtcgaagcggcgctgcggctcgcccggcaagcaacgggacggcccaacgtcatc
gttttccacggcggcttccacggacgcacggttgcagcagcctcgatgacgacgtctgga
acccggtttagtgcgggcttcagcccgctgatggcgggagtgcatgttgcgccgttccct
acggcattccgctggggctggagcgaggaggaggcaactgacttcgctctgcgcgagctc
gactacctcttcgcgacgatcagctcaccgaaggagacggcagcgttcatcgtcgagccg
gtattgggtgagggcgggtatgtgcccggaaacacgcggtttttccagggcctccgcgag
cgcgccgatcagcatgggatcgtgctgatcctcgatgagatccagacgggcttcggccgc
accggcaagttcttcggccatcagcacttcgatatcaagcccgacgtcatcacgattgcc
aagggactggccagcgggttcccgctctccgggattgccgcaccggaagcgttgatggcc
aaagcctggcctggctcgcagggtggcacgtacggcggaaacgcggttgcttgtgccgct
gccgtcgcgacgatcgatgtcatccgtgacgaagggctggtagacaatgccgcccagcgc
gggacgcaactcttgcacggtgcggcgaatctggccaccaaagctatcggtgacacccgt
ggcctcggcctgctcgtgggcagtgagttcgtcgacgagaacggcaagcccgacggcacg
aaagccgcagcagctcaacaacttgccgggaagaaggggttgttgctgctgatgtgcggc
gcgtacatgaacaccgtgcgcatgattccgccgctgatcgtgacaagcgagcagattgac
gaaggtttgagcatctgggaggaagtgctcgccgagatctga

DBGET integrated database retrieval system