KEGG   Alligator sinensis (Chinese alligator): 102370061Help
Entry
102370061         CDS       T02922                                 

Definition
(RefSeq) snake venom serine protease-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102370061
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102370061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 504 aa AA seqDB search
MAMMGTAPCLLVFLLLPAFLGGLQREDRVLGGSECQKGAHPWLVLLYYFDKHYCSGALLN
QNWVLTAAHCSMRHIQVRLGEHNISTSTGYEQFSTVQEAIIHPGFVDGTSGLRSYENDIM
LLRLKPPAVYTSYVQPIDLPTLCPLPMGTTCTVMGWGTTSSPEETYPNVPQCLDITTVPL
AQCQATYPEKVTENMLCAGGAQEGKDSCQGDSGGPLLCNRKLYGLVSWGDFPCGKLGQPG
IYTNVCCYLDWIRTTMEGGPLLTCFPPYIVATAQDGGDKVIEGYPCQPNSQPWQAYLQGS
TFCGGVLLNRHWVLTPAHCKMAGVAQLVRLGVHNRRLPSLMEQRHRVIKTIVHPNYNPQT
YNNDIMLMRLQRPVVVTKSVQPVALPRACPRAGQSCLVSGWGTTHSPGAIYPNILQCAQL
QILSNEFCRKAYGAWFTPNMMCAGIPGRRVDSCQGDSGGPLTCGRVLQGIVSWGPPVCGR
PNEPGVYTRVCNYLSWIRDIINGN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatgggcactgcaccgtgcctgctggtgttcctgctactcccagccttcctg
ggagggcttcagcgggaggatcgggtcctgggaggctcagagtgccagaagggcgcccac
ccctggctggtgctgctctactactttgacaagcactactgctctggcgccctcctgaac
caaaactgggtgctcacagctgcccactgctccatgagacatatccaggtgcgtctaggt
gagcacaacatctccacatcaacggggtacgagcagttctcgacggtccaggaagccatc
atccacccaggctttgtcgatgggacgagcgggcttcgcagctatgagaatgacatcatg
ctcctgcggttgaagccccctgctgtttacacatcctatgtgcagcccattgacctaccc
acgctctgccccctgcccatgggcaccacctgcaccgtgatgggctgggggaccaccagt
agtccagaggagacctaccccaacgtgccccagtgcctggacatcaccacagtgcccctg
gcccagtgccaggccacctacccagagaaggtcactgagaacatgctgtgcgccgggggt
gcccaggagggcaaggactcctgccagggcgactccggaggccccctgctgtgtaacagg
aagctctacggccttgtctcatggggtgacttcccatgtgggaagctcggccagccgggg
atctacaccaacgtctgctgttaccttgactggatccgcaccaccatggaggggggcccc
ttgctgacctgcttcccaccctacattgtagccacagcccaggatggaggcgacaaagtc
attgaggggtacccgtgccagcccaactcccagccctggcaggcctacctccagggctcc
acgttctgcggaggtgtgctcctgaaccgccactgggtgctgacccctgctcactgcaag
atggcgggggtggcacagcttgtgcgcctaggtgtccacaaccggcgcctccccagcctc
atggagcagcgccatagggtcatcaagacgattgtccaccccaactacaacccccaaacc
tacaacaatgacatcatgctgatgcggctccagcgtccagtggtcgtgaccaaaagtgta
cagcccgtggccctgccccgcgcctgcccccgtgctgggcagtcctgccttgtatctggc
tggggcaccacacacagccctggagctatataccccaacatcctacagtgtgcccagctc
cagatcctctccaatgagttctgccgtaaggcatatggtgcatggttcacacccaacatg
atgtgcgccggcatcccagggcgccgtgttgatagctgccagggcgactccggaggtccc
cttacgtgtggcagggtccttcagggcattgtgtcctggggcccaccagtctgtgggcgg
cccaatgaacctggtgtctacacccgggtgtgtaactacctgtcctggatccgggacatc
ataaatgggaactag

DBGET integrated database retrieval system