KEGG   Alligator sinensis (Chinese alligator): 102371839Help
Entry
102371839         CDS       T02922                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102371839 (HDAC6)
Protein phosphatases and associated proteins [BR:asn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102371839 (HDAC6)
Messenger RNA biogenesis [BR:asn03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102371839 (HDAC6)
Membrane trafficking [BR:asn04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    102371839 (HDAC6)
Chromosome [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102371839 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 1119 aa AA seqDB search
MVSPTPPSAHVQGNCVAQPRLPRAVRMVSLRAGQSDSIRQRPGETIFLKGGEQVKPFPPH
PDLQPLTPTCNPPCLAAAMPPGVSPGPEGPSAPAPSGRAGRRAPPPPRRSPGLPEAKRRG
RARRLHQEVAELQDGLQHLDLAAEKPVPSGTGLAYDKELTSFHCLWDKSFPECPARLTSI
WTKLVEDGLVERCVPVQARLATEEEILLVHSPQFLALMASTADMEEGKLRALSDTYDSVY
LHPNSYHCARLAAGTVLAVVDKVLSGELRNGLALIRPPGHHAQRERMEGYCLFNHVAIAA
RHARERRGLQRVLIVDWDVHHGQGTQFIFEDDPSVLYFSVHRYDNGAFWPHLPDSDSSAV
GRGQGCGFTINLPWNQPGMTDADYISAFLQLLLPVAFEFQPQLVLVAAGFDAAIGDPKGQ
MLVSPACFAHLTHMLLALAGGKVVLALEGGYNLHSLTEGVSAALGSLLGDPCPPLAGPAA
PCPSALQSISKALGIHAQFWPSLQHVEVSALSTEDEGVEEALGETGGVPSPVELPCPEAL
PSLEAPPPRRPPACTGLVYDERMTQHYNMWDSQHPERPQRVTRALSRLQELGLERRCLRL
PPRLATEPELLLCHSPEYVARLRATVGLRPRELHRAGSRYNSVYMCGESFEAACLAAGCV
LSAVDAVLAGQVQNAVAVVRPPGHHAEPDAACGFCLFNSVALAARYAQQVAGRPLRVLIL
DWDIHHGNGIQHIFEEDPSVLYISLHRYDAGAFFPGGPAGGAGQVGRGQGRGYTLNVPWE
EPRAGDLEYLPALLRLCLPVAYQFRPELVLVAAGFDAAQGDPLGGCLVTPQGYGTMAWLL
ATLACGRLILALEGGYNLAATAESLATCVRALLGDPPLAPPPVLALPLSPHPQPSALHAL
SLASAVHRTYWACLRLHVPSMDCDASEDRSPAPQEALPPDDLSSLGSLSLEDRSQEGMGS
PDSVPVGWTRRKMKTEPELEGVGINPEGEEGPPEGAGLAAPDLPEDALYAVTPLSWCPHL
SSVAPVPPAGLDILAPCQKCGCQGENWVCLTCYQVLCSRYVAGHMVAHGDASGHPMVLSF
ADLSAWCYDCEAYIHHPTLLPAKILAHRLKFGNELPALL
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggtctctcccacccctccaagtgcgcatgtgcaggggaattgtgtcgcccagccccgc
ctgccccgcgcggtacgaatggtctcgctcagggcgggccaatctgactccatccggcag
cgcccgggagagaccatctttctgaaggggggggaacaggtgaaaccatttcccccccac
cccgacctgcagcctctcacgcctacttgtaatcctccctgccttgccgccgcgatgccc
cctggggtctctccagggcctgaaggacccagcgccccggcaccgtcgggccgggctggt
aggcgggcaccacctcctccccgccgcagcccagggctccctgaggcaaagcggcgtggc
cgcgcccggaggctgcatcaagaggtggcggagctccaggacgggttacagcacctggat
ctggctgcagagaagccagtgccctcagggacaggccttgcttatgataaggagctcacc
agctttcactgcctttgggacaagagtttccctgagtgcccagcccggctgacatccatc
tggaccaagctggtggaagatggattggtggagaggtgtgtccctgtgcaggccagactg
gctacggaagaggagattctgctggtacacagcccccagttcctggccctcatggcctca
accgccgacatggaagagggtaaactccgcgccctctcagacacttacgattcagtttat
ttgcatccgaattcataccactgtgcgcggctggcagccggcactgtcctggctgtggtt
gacaaggtgctgagtggggagctgaggaatgggctggcgctgatccggccaccagggcac
catgcacagcgggagcgtatggagggctactgcctcttcaaccatgtggccatcgctgcc
cgtcacgcccgggagcgccgtggattgcagcgggtcctgattgttgactgggatgtccac
catgggcagggaacccagttcatctttgaagatgaccccagcgtcctgtacttctcggtc
catcgctatgacaacggggcattctggccccatctcccggattctgattcatcggctgtg
gggcgggggcaaggctgtggcttcaccatcaacctgccctggaaccagcctggcatgacg
gacgccgactacatctccgccttcctccagctcctgctgcctgtagccttcgagttccag
ccccagctggttcttgtggctgctggctttgatgctgccattggggaccccaaggggcaa
atgttggtgtcacctgcctgcttcgcccacctcacccacatgctgctggcgctggctggg
gggaaggttgtgctggccttggagggcggctacaacctccactctctcactgagggggtc
agtgctgccctggggtctctcctgggagacccctgccccccactggccgggccagctgcc
ccctgtcccagcgctctccagtccatctcaaaggctctgggtattcatgcccaattctgg
ccctctctgcagcatgttgaggtctcggcactttccacagaggatgagggagtagaggag
gcactgggggagacagggggggtcccatccccagtggagctgccctgcccagaggctctg
ccttccttggaggccccaccaccacgccgcccccccgcctgtaccggcttggtctatgat
gaacgcatgacccagcactacaacatgtgggacagccagcacccagagcggccacagcgg
gtgacccgggccctgagccggctgcaggagttggggctggagcgacggtgcctgcgcctg
cctccccgtctggctactgagcccgagctgttgctgtgccacagcccagagtacgtggcc
agactccgggccacagttgggctgcgcccgcgagagctacatcgtgctggttcccgctac
aactcagtctacatgtgtggggagtcctttgaagctgcatgcctggcagctggctgtgtc
cttagcgctgtggatgccgtgctggctgggcaggtgcaaaatgcagtggccgtggtgcgg
cccccagggcatcacgcagagcctgatgctgcctgtggcttctgcctcttcaattcagtg
gccctggcagcccgctatgcccagcaggtggctggccggcccttgcgggttctgattctg
gactgggatattcaccatggcaatggaatccagcatatttttgaggaagaccccagtgtg
ttgtacatctccctgcaccgctatgatgctggcgccttctttccaggggggccagcagga
ggagcagggcaggtggggcgggggcaggggcggggctacacccttaatgtgccgtgggag
gagcctcgtgccggggacctcgaatacctgcctgccctgctgcgcctctgcctgcctgtc
gcttaccagttcaggccggagctggtgctggtggcagctgggttcgatgcggcacaaggc
gatcccctgggcggctgcctggtgaccccccagggctatggcaccatggcctggctgctg
gctacgctggcctgcggccgccttatcctggcccttgagggtggctacaacctggcagca
acagcagagtccctggccacgtgcgtccgggcactgctgggagaccccccactggcccca
cctccagtcctggcactacccctgtctccacacccccagcccagtgctctccatgccctc
agcctggccagcgctgtgcaccgtacctactgggcctgccttcgtctccatgtgccctcc
atggactgtgatgcctctgaggacagaagcccagccccccaggaggccctgcctcctgat
gacctctcctccctgggttccctctccctggaagacaggtcccaggaggggatgggcagc
ccagactctgtccctgtgggctggaccaggaggaagatgaaaacagagcctgagttggaa
ggggtggggattaacccagaaggggaggaaggtcctccagaaggggcggggcttgcagcc
ccagatttaccagaggatgcactctatgctgtgacaccgctgtcctggtgcccccacttg
agctctgtagcaccagtgcccccagctgggctggacatcctggcaccgtgccagaagtgt
gggtgccagggtgagaactgggtctgcctcacctgctaccaggtgttgtgcagccgctat
gtggcaggtcacatggttgcccatggtgatgcttctggccaccccatggtcctgagtttc
gcggacctctctgcctggtgctatgactgtgaggcctatatccatcacccaacccttttg
ccggccaagatcttggctcatcgcctcaagttcggcaatgagctgcctgcactactttga

DBGET integrated database retrieval system