KEGG   Alligator sinensis (Chinese alligator): 102376572Help
Entry
102376572         CDS       T02922                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102376572 (HDAC7)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102376572 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102376572
NCBI-ProteinID: XP_014381019
UniProt: A0A1U8DTJ7
LinkDB All DBs
Position
Un
AA seq 989 aa AA seqDB search
MDLRIGQRFVKPGSDTALLALKQTQQLQHQFFLASLHQQQVEQLTHQQMRVNMESPHQEA
EVGQQEQELRQLLNKDKSKRSAVASTVVKQKLAEVILKKQQAALERTSNPNPSAMPYRTL
EPLDTEGPAPPVLTSFLAQVPSTIDPPEHFPLRKTGKPPPGHWVLANLKVRYKPKKSLDR
RKNPLTRKESAPPSLKRRPPEAIDSSPSSSSTPVSGCSSPNDSLPAEHGALPTGPGLVHE
TPLAQRLMMQESSLAQFAQQSAATLPTITLGLPATTSGRGEADRHMLSSLTHGRVPVLNG
PVLAGTHPPMFIPASLEQHEPGGTLSPRVIILEPSVTHTPLVAVPGLGPVPFSFAPSLIT
AERLPLPGHHKPLGRTRSEPLPQNPKAIQQQLAYQQHHAQFLERLKQQTALGKRMAKSSE
KPRLRQIPSSEDMEAEVGHPEGGGERSDQARGRLESARPGASVKEPERTQKPMQPQEELV
LQQPYMWEPYQRMQQQLLKRQLPADTLVAPSIHGGHRPLSRAQSSPATATISLPTQETPT
KALALPVQEPPAKPHFTTGLVYDSVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQERGLRS
QCECLRGRKATLEELQSVHNERHVFLYGTNPLNRLKLDNGKLAGILSQRMFVMLPCGGVG
VDSDTIWNELHSSNAARWAAGSVTELAFKVATRELKNGFAVVRPPGHHADPSTAMGFCFF
NSVAIAARQLQQKGKLSKILIVDWDVHHGNGTQQVFYRDPDILYISIHRHDDGNFFPGSG
AADEVGSGLGEGFNVNVAWTGGLDPPMGDPEYLAAFRTVVIPIAHEFSPDVVLVSAGFDA
ADGHLPPLGGYKVSAKCFGYMTKQLMSLAGGAVVLALEGGHDLTAICDASEACVSALLGN
EPDPLPEESLRQKPNPNAVRSLETVIQVQSKYWSTVQRFASKVGCSFLEAQHHEAEEVET
VTALASLSVAVMAEKRAQDEPMEEEPMNQ
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgcatcgggcagcgctttgtcaagcccggctcggacacggccctgcttgct
ctgaagcagacgcagcagctgcagcaccagttcttcctggccagcctgcatcagcagcaa
gtggagcagctcacccaccagcagatgcgggtgaacatggagtccccgcaccaggaggca
gaagttgggcagcaggagcaggagctgcggcagctccttaataaggacaagagcaaacga
agtgcggtggccagcaccgtggtcaaacagaagctggctgaggtcatcctgaagaaacaa
caggctgctttggaaaggaccagcaaccccaacccctccgccatgccctacaggacccta
gagccgctggataccgaggggccggcacctcctgtgctcaccagcttcctggctcaggtc
cccagcaccatagaccccccagagcacttcccgctgcggaaaacaggtaagccacccccg
gggcactgggtcctggcgaacctcaaggtgcgctacaagcccaagaagtccctggaccgg
cgcaagaacccgttgacccgcaaggagagcgcgcccccttcgctgaagaggcggccgccg
gaggctatcgactcgtcccccagcagcagcagcaccccggtgtccggctgcagctccccc
aacgacagcctcccagcagagcatggggccttgcccacggggcctggcttggtgcacgag
acgccactggcccagcgcctgatgatgcaggagagctcactggcccagtttgcccagcag
agcgcagccacgctaccaaccatcacactgggactgcccgctaccaccagtggcagggga
gaggcagaccgccacatgctctccagcctgacccatggacgggtgccggtgctgaatggg
cctgtcctcgctggcacgcacccgcccatgttcatccctgccagcttggagcagcacgag
cctggggggaccctgtccccacgtgtcattatcctcgagccctcggtcacccacactcca
cttgtggcagtgccgggcctggggccagtgcccttctctttcgccccctcgctgatcact
gctgaacgtcttccgctgcccgggcaccacaagccgctggggcgcacccgctctgagccc
ttgccccagaaccccaaggccatccagcaacagctggcgtaccagcagcaccatgcccag
ttcctggagcggctcaagcagcagacggctttgggcaagcgcatggcaaagtccagcgag
aagccccgtctacggcagatcccctcctctgaggacatggaggcagaggtgggacacccg
gaaggagggggcgagcgcagcgaccaggccagggggcggctggagtcggcccggccgggg
gccagcgtgaaggagcctgagaggacccagaagccaatgcagcctcaggaggagctggtt
ctgcagcagccctacatgtgggagccctaccagcgcatgcagcagcagctcctcaagcgc
cagctcccagccgacactctggtggcaccgagcatccatggagggcaccggcccctgtcc
agggctcagtcttctcctgccacggccaccatctccctgcccacccaggagacgcccacc
aaggcactggctctgccagtgcaggagccgccagccaagccacacttcacgacagggctc
gtgtatgactcggtgatgctcaagcaccagtgctcctgcggggacaacagcaaccacccg
gagcatgcgggacgaatccagagcatctggtcccgcctgcaggagaggggactgcgcagc
cagtgcgagtgcctgcggggccgcaaggcgacgcttgaggagctgcagtcggtgcacaac
gagcgccacgtcttcctctacggcaccaaccccctcaaccgcctgaaactggacaacggc
aagctggcagggatcctgtctcagaggatgttcgtcatgctgccctgtggcggggtaggg
gtggacagcgacacgatctggaacgagctacattcatccaatgctgcccgctgggccgcg
ggcagcgtcacggagctagcctttaaggtggccacgagggagctgaagaacggttttgcc
gtggtgagaccccccggacaccatgcggacccctccacagccatgggcttctgcttcttc
aactcagtggccattgcggccaggcagcttcagcagaaggggaaactcagcaagatcctc
atcgtggactgggatgttcaccacggcaatgggacccagcaggtgttctaccgggacccc
gacatcctctacatctccatacaccgccacgacgacggcaacttcttccccggcagcggg
gcggctgacgaggttggctctggcctcggtgagggctttaatgtcaacgtggcctggacc
ggtggcctcgacccccccatgggagacccggagtacttggcagctttcaggacagtcgtg
ataccaattgcccacgagttctccccggacgtggtgctggtgtctgcggggttcgatgca
gctgatggccacctgccacccctgggaggctacaaagtctctgccaagtgcttcggctac
atgaccaagcagctgatgagtctggcaggaggagccgttgtcctcgccctggaaggcggc
catgacctcacagccatctgcgacgcctcggaggcctgtgtctcagccctgctgggcaac
gagccggatcccctccccgaggagagcttgaggcagaagcccaaccccaacgctgtgcgc
tccttggaaacagtgatccaggtccagagtaaatactggagcaccgtgcagcgctttgct
tccaaggtcggctgctccttcctggaagcgcagcaccacgaagcggaggaggtggagacg
gtgacagccttggcctcactgtcggtggccgtgatggcagagaagagagcacaggacgag
cccatggaggaggagcccatgaaccagtga

DBGET integrated database retrieval system