KEGG   Alligator sinensis (Chinese alligator): 102377633Help
Entry
102377633         CDS       T02922                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102377633 (PCSK1)
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S8: subtilisin family
   102377633 (PCSK1)
Chaperones and folding catalysts [BR:asn03110]
 Intramolecular chaperones
  Subtilisin family
   102377633 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 102377633
NCBI-ProteinID: XP_014373534
UniProt: A0A1U8D770
LinkDB All DBs
Position
Un
AA seq 771 aa AA seqDB search
MPAGGLSWRRHQLPARRPESRPQSLAETGQELLLSPPLSEKKLQLRDTRQPPPPTHQPRS
RIRSAGFWHIVYNHTQIQQQLRQIGSLKNHYLFRHKSHPRRSQRSAVRISKRLSDDERVS
WAEQQYEKKRTKRAALRDSAENLFNDPMWNQQWYLQDTRITPSLPKLDLHVIPVWQKGIT
GKGVVITVLDDGLEWNHTDIYANYDPQASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIA
MQANNKKCGVGVAYNSKVGGIRMLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTV
EGPGRLAQKAFEYGINQGRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQ
GLSPWYAEKCSSTLATAYSSGDYTDQRITSADLHDECTETHTGTSASAPLAAGIFALALE
ANPNLTWRDMQHLVVWTSEYDPLAGNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKV
WKSVPEKKEGIVKDNSFEPRLLRANGEVTIEIPTKACEGQENSVASLEHVQFEATIEYSR
RGDLHVTLTSPSGTSTVLLAERERDKSPNGFKNWDFMSVHTWGENPAGTWVLRITDVSRR
IQNEGRIVNWKLILHGTSVQPEHMKQPRVYTNYNAVQNDRRGVEKMTDFVEDHTTQENLK
EKSKVTGGTSGSTDKMGDKIPSEAMLHLLQSAFSRQMSQNRAPKKTPSEKLNIPYEHFYQ
ALEKLNKPSQLRDSEESLYSDYVDLFYNTKSYKHRDDRLLQALVDILNEEN
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctggcggtttgtcttggcgaagacaccagctccccgctaggcgacctgagagc
cggcctcagtcgctagcagaaacgggacaggagttgttgctttctcctcctctctctgag
aaaaagctccagcttcgtgacacaaggcaacctccgcccccaactcaccaacctagaagt
cggatccgatcggctggtttttggcacatagtatacaaccacacccaaatacaacagcaa
ctgaggcaaattggatcactcaaaaatcactacttattcagacataaaagccatccaaga
aggtctcaaagaagtgctgttcgtatctctaagaggctttctgatgatgagcgggtgtca
tgggcagagcagcaatatgaaaaaaagcgaactaagcgtgcagccctgagagactctgca
gaaaatcttttcaatgatcctatgtggaatcagcagtggtacctgcaagatacaaggatt
actccctctctgcctaagctagatctccatgttatacctgtatggcaaaaagggattaca
ggcaaaggtgttgttataactgtcctggatgatggcttggagtggaatcacactgacatc
tatgctaactatgatccacaggcaagttacgatttcaatgacaatgatcatgatcccttt
cctagatatgatccaacaaatgaaaacaagcatgggacacgatgtgcaggagaaattgcc
atgcaagccaataacaagaagtgtggagttggagtagcatataattccaaagtgggaggt
atacgaatgctggatggaatagtcactgatgccattgaagccagttcaatcggttttaat
ccagaacatgtggatatttacagtgcaagctggggtccaaatgatgatggtaaaactgta
gagggtcctggcagactagcacagaaggcttttgaatatgggatcaaccagggccgaaat
ggaaaaggttccatttttgtatgggcttctgggaatggtggtcgtcagggtgataactgt
gactgtgatggctacacagatagtatctacactatctccattagcagtgcttcccaacaa
ggcctttctccttggtatgcagagaagtgctcctcaactctcgccacagcatacagcagt
ggggattatactgaccagagaattacaagtgctgatcttcatgatgaatgtacagagact
cacactggaacctctgcatctgctccattggcagcggggatttttgctctagcccttgaa
gcaaaccctaatctaacatggagggatatgcaacatttggtagtctggacatcagaatat
gacccactggctggtaatccaggatggaagaaaaatggagcagggttgatggtgaatagc
cgatttggatttggattacttaatgccaaggcactggtggatttagctgatcctaaagtg
tggaaaagtgtgcctgaaaagaaagagggtatagtcaaggacaacagttttgaaccaagg
ttattaagagcaaatggtgaagtaaccatcgaaattcccacaaaagcttgtgaagggcaa
gagaattctgttgcatctttggaacatgtgcagtttgaggcaacgattgaatattcccgc
agaggtgatctgcacgtcactctcacttccccatcaggcaccagcactgttctactggct
gaaagggagagagataagtctcccaatggctttaaaaattgggacttcatgtctgttcac
acatggggagagaacccagcaggtacttgggttttaagaattactgatgtgtccaggaga
atccaaaatgaagggaggattgtgaactggaaactgattttgcatggcacttctgtccaa
cctgaacatatgaaacagcctcgtgtatacacaaactacaatgctgtgcaaaatgacaga
aggggagtggagaagatgacagactttgtagaggaccacaccacgcaggagaacctaaag
gaaaaatccaaagtcacaggaggtaccagcggtagcactgataaaatgggagacaaaatc
ccatcggaggcgatgcttcacctattgcaaagtgctttcagcaggcagatgtcccagaat
cgagcaccaaagaagactccaagtgaaaagttaaatattccatatgaacatttctatcaa
gcccttgaaaaattaaacaagccctcccagttaagagactcagaggaaagtctatacagt
gactacgttgaccttttttacaacaccaaatcatacaagcatagagatgatagactgctg
caggccttggttgatattttgaatgaagaaaactaa

DBGET integrated database retrieval system