KEGG   Alligator sinensis (Chinese alligator): 102380189Help
Entry
102380189         CDS       T02922                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102380189 (SETDB2)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102380189 (SETDB2)
Chromosome [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102380189 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102380189 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 716 aa AA seqDB search
MHDTCVQLLQRMEQTKSDLQTVWREMEDERVDFIFEQMQNLLLSLKQKIKDGSATSKECF
QACMLLKEANLSNLFTSTNVNDVTDEDTMQKSESRLQPSESNGNRTDTEDNSLLNMEEKE
KSCSENEEAANEIMELPLTLPYQNHNCSNACLANRPLNSYKSENPLKIPILCQFQRRHAK
ADCLSKSHDVNYKAPCGKSLRNFEEVQNYLLETECDFLSVDHFSFNTYVQLGRNTVNQEP
LVFDFDISSGAEVVPISFCNDIDRTRLPFFKYRKASWPRGYYLNNFSSTFVDSCDCTNGC
KNRLKCACLQLTARGFSESSMSPNKVLCGYKHKRLEMPITSGIYECNVSCRCNRMLCQNR
VVQHGIQVRLQVFNTEKKGWGVRCLDDIDKGTFVCTYSGRLMSRAESQETGDVNHEDNEQ
DAESGRSHSSLPKKRRGDAACSDSEIELVQTGKGALHVEYEPLTQPLDAENKPPELQNNG
CNPNNLINSGVRRPKARIDFLHNHQPELGVDTLAHDATSDEDSSLSQQSTKLKPTTGTRR
RKGKLNLRQELEDLEETMQVESVVSLGAKCKEGTSPQDLAHGKLVTQGDAYAVKKDRALF
QKSEFKEENCKSSKQDPFCHETLLKNSDQENIYLLDATKEGNVGRFLNHSCCPNLFVQSV
FVETHNKNFPWVAFFTNRHVKSGTELTWDYGYEAGSMPETEIPCQCGVQKCRKKIL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatacgtgtgtacaactactccaaaggatggaacaaactaaaagtgacttacag
acggtttggagggagatggaagatgaaagagtggactttatatttgagcagatgcaaaac
ctgttgctgtctctgaaacaaaagatcaaagatggaagtgcaacaagcaaagagtgcttc
caagcttgcatgctgttgaaagaggctaatctaagcaatcttttcacatcaacaaatgta
aacgatgtgactgatgaagataccatgcagaaaagcgaatctagattacagccttctgaa
tcaaatggaaatagaacagatacagaagacaattctctcttgaacatggaagagaaggaa
aagtcatgttcagagaatgaagaggcagctaatgaaatcatggagttacctttaacattg
ccttatcagaatcacaattgctctaatgcatgtcttgccaacagaccactgaactcctac
aagagtgaaaacccccttaagataccaatcctgtgtcagttccaaagacgacatgcaaaa
gcagactgtctttccaagtcacatgatgtgaattataaagccccctgtgggaagagtctg
agaaattttgaagaggtgcagaattacctgcttgaaacagagtgtgacttcttatctgtt
gatcacttttccttcaacacatatgtacagctgggcaggaacactgtaaaccaagaacca
cttgtatttgattttgatatcagcagtggagctgaggtggtgcccatttccttctgcaat
gacattgaccgtacaagattacctttctttaaatacagaaaggcatcatggccacgtgga
tactatctgaacaacttttccagcacgtttgttgattcatgcgactgtacaaatggctgc
aaaaataggttaaaatgtgcatgcctacagctgactgcaagaggctttagtgaaagttcc
atgtcgccaaataaagtactttgtggatataagcataaaagactggagatgcccattact
agtggaatttacgaatgtaacgtatcatgcaggtgtaaccgaatgttgtgtcagaacaga
gtagtacagcatggcatccaggttcggttacaagtgtttaacacagaaaagaaaggctgg
ggagtccgctgccttgatgatattgacaaaggaacatttgtttgcacttactcaggcagg
ctgatgagcagagctgaatctcaggaaacaggtgatgttaatcatgaggataatgaacaa
gatgccgagagtggcagaagtcacagctcacttccaaaaaaaagaagaggggatgctgct
tgttcagattctgagattgagcttgtgcagactggtaaaggtgctcttcatgtggagtat
gaacctttgactcaacctttagatgctgaaaacaaaccacctgaacttcagaataatgga
tgtaatccaaataatttgatcaactctggtgttagaagacctaaagccagaatagatttt
ctccacaatcaccagccagaactgggagttgatacactggcacatgatgccacctcggat
gaagatagctctttatcccagcagtcaaccaaattgaaaccaaccactggaaccaggaga
agaaaaggaaaactaaacctgcgacaggagctagaggatctggaggagaccatgcaggtt
gaatctgttgtcagccttggtgcaaagtgcaaagaggggacatctccacaggatcttgca
catggtaaattggtcacacaaggtgatgcttatgctgtgaaaaaggacagggctctattc
caaaagagtgagttcaaagaagaaaactgtaagagctccaaacaagatcctttttgtcat
gagacgcttctgaagaattctgatcaagaaaacatttatttgttggatgccacaaaagaa
ggaaatgtgggtcgatttcttaatcatagctgctgcccaaatctctttgtgcaaagtgtc
tttgtagagactcacaacaagaatttcccctgggtggcattcttcacaaacaggcacgtg
aaaagtggaactgaactcacgtgggattatggttatgaagctggaagcatgccagagact
gagatcccctgtcagtgtggcgttcagaagtgcaggaaaaaaattttatag

DBGET integrated database retrieval system