Alligator sinensis (Chinese alligator): 102384075 Help Entry 102384075         CDS       T02922                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:asn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102384075 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:asn04121]     102384075 (ELOC)    03400 DNA repair and recombination proteins [BR:asn03400]     102384075 (ELOC) Ubiquitin system [BR:asn04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      102384075 (ELOC)    Cul5 complex      102384075 (ELOC) DNA repair and recombination proteins [BR:asn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102384075 (ELOC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  102384075 NCBI-ProteinID:  XP_006015354 UniProt:  A0A1U7RJA2 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacgtatggtgggtgtgagggccctgatgctatgtatgtgaaa ttgatatcctctgatggtcatgagttcattgtaaaaagagagcatgcattaacatcagga acaataaaagcaatgttgagtggcccaggacagtttgcagaaaacgaaacaaatgaggtg aattttagagagattccatcccatgtcttatccaaagtatgcatgtatttcacctacaag gttcgctacactaacagttcgacggagattcctgaattcccaattgcacctgaaattgca ctggaacttctgatggctgcaaacttcttagattgttaa

DBGET integrated database retrieval system