KEGG   Acinetobacter soli: BEN76_07200Help
Entry
BEN76_07200       CDS       T04684                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
asol  Acinetobacter soli
Brite
Enzymes [BR:asol01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BEN76_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: APV35819
UniProt: A0A1P8EI06
LinkDB All DBs
Position
1490022..1490648
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYAYDALEPHISKETLEYHHDKHHQTYVTNLNNLIKGTDLEGQELEDIIKA
SAGDSSKAGIFNNAAQVWNHTFYWNSIAPNGGGKPTGALAAKIDEAFGSYEKFAEEFTTA
ATTQFGSGWAWLVADEINGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDYRNARPK
YISTFLESLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttaccagctttaccttatgcttatgatgcactcgaaccacatatt
tctaaagaaactttagaataccatcacgataagcaccaccaaacttatgtgactaatctg
aacaacctgatcaaaggcacagatcttgaaggtcaggaacttgaagacattattaaagca
agtgcaggcgattcatctaaagcaggtattttcaacaatgctgcacaagtatggaaccac
actttttactggaactcgattgctccaaacggcggtggtaaaccaacaggcgcacttgct
gcaaaaattgatgaagcatttggttcatacgaaaaatttgcggaagaattcaccactgct
gcaaccactcaatttggttcaggttgggcgtggttagtggctgacgaaatcaatggtaaa
ctttcaattactaaaacttcaaatgcagacactccgcttgcacacggtcaaattgctgta
ttgaccattgacgtatgggaacatgcttactacatcgactaccgtaacgcgcgtcctaag
tacatctcgactttccttgaaagcctagtgaactgggattatgcaaacgcgaaacttgct
ggccaacctgctggcgttgaaaaataa

DBGET integrated database retrieval system