KEGG   Alteromonas stellipolaris LMG 21856: AOR13_3913Help
Entry
AOR13_3913        CDS       T04153                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
asp  Alteromonas stellipolaris LMG 21856
Brite
Translation factors [BR:asp03012]
 Eukaryotic Type
  Elongation factors
   AOR13_3913
 Prokaryotic Type
   AOR13_3913
Mitochondrial biogenesis [BR:asp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AOR13_3913
Exosome [BR:asp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AOR13_3913
  Exosomal proteins of breast cancer cells
   AOR13_3913
  Exosomal proteins of colorectal cancer cells
   AOR13_3913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4514244..4515425
Genome map
AA seq 393 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKTYGGSAQAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYEFPGDDLPVIQGSALKALE
GDAEWEKKIIELGEALDSYIPEPERAIDKPFILPIEDVFSISGRGTVVTGRVEQGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREDVERGQVLAKPGSIN
PHTKFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNLKFV
VELIAPIAMDEGLRFAIREGGRTVGAGVVAKIL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgaacgtacgaaaccccatgtaaacgtgggtacaatcggccac
gttgaccacggaaaaactacccttactgcagctatcactactgttctttcaaagacatac
ggtggttcagctcaggctttcgatcaaatcgataacgcgcctgaagaaaaagctcgtggt
atcaccatctctacttcacacgtagagtatgacactcctactcgtcactacgctcacgta
gattgcccaggacacgctgattacgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctagtagtagctgcgactgatggccctatgcctcagactcgtgagcacatc
ctacttggtcgtcaggttggcgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgatgatgaagagcttctagagctagtagaaatggaagttcgtgaacttcttagcgaa
tatgaattcccaggcgatgaccttccagttatccaaggttctgcacttaaagcccttgaa
ggcgacgcagaatgggaaaagaaaatcatcgaacttggtgaagctcttgattcatacatt
ccagagccagagcgtgctatcgataagccgttcattcttccaattgaagacgtattctca
atctcaggccgtggtactgtagtaactggtcgtgtagagcaaggtattgttaaagttggt
gaagaagtagaaatcgttggtatcaaagatacaactaagacgacttgtactggtgttgaa
atgttccgtaaacttcttgacgaaggtcgcgctggtgagaacgttggtgttcttctacgt
ggtactaagcgtgaagacgttgaacgtggtcaagtactagctaagcctggttcaatcaac
ccacacactaaattcgaagctgaagtatacgtactaagcaaagacgaaggtggccgtcat
actccattcttcaaaggctatcgtccacagttctacttccgtacaactgacgtaactggt
gctgtagagcttccagaaggcgtagagatggtaatgccaggtgacaaccttaagttcgta
gtagaacttattgcaccaatcgcgatggacgaaggtttacgcttcgctatccgtgaaggt
ggccgtactgtaggtgctggtgttgtagctaagattctttaa

DBGET integrated database retrieval system