KEGG   Aeromonas schubertii: WL1483_3007Help
Entry
WL1483_3007       CDS       T04186                                 

Gene name
pulA
Definition
(GenBank) Pullulanase
  KO
K01200  
pullulanase [EC:3.2.1.41]
Organism
asr  Aeromonas schubertii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WL1483_3007 (pulA)
Enzymes [BR:asr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.41  pullulanase
     WL1483_3007 (pulA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1593366..1597703
Genome map
AA seq 1445 aa AA seqDB search
MTEDAGSGIWAFDGAASLEGSFYRYAIEAYHYKSGKLERMTTTDPYSVSLSTASRFSQLV
NLDGEQAKPVGWDAQSVPPLAKPEDSIIYELHIRDFSNSDKEGTAAFNGKYLAFTEGARA
SVQHLKLLREAGLNTIHLLPSFDLSSVEEEAARRMDLDDDVSKLCDPAKGLNPKAALCAR
AGSGTLRSLLEGLDPASGDVQALLAEIRPKDGFNWGYDPYHYNAPEGSYAVESDGLPRIR
EYRTMVQALHQMGFRVVQDVVFNHTSSSSLYNTSVLDKVVPGYYHRRNPDNGLVESSTCC
DNTASEHRMFEKLVADSLVSWATEYKIDGFRFDLMGHLMKSSVVKAFDAVKRVDGDTWFY
GEGWDFGEVQNNARGVNSSQWNMAGTGIGTYNDRLRDAVRGDHSDPMNGTPGFANAGDRF
DAMGNKMDLIRLGMAANLQTYPLPTDGGLVLGRDYQFGGHGAGYAADPQETVNYVSKHDN
QTLWDINQYKAKGEVSPLDRARMQIVGLAPVLLGQGVPFLHMGSELLRSKSMERDSYDSG
DWFNRVDFSKQGNNWNVGLPRQDKDGSNWEWIGRIIANPNTRVGPAEIAWSDARFRELLA
IRAGSELLRLGETDQILKRVRFHAIGSQARPGTIVMTADDGVAAGADLDPANQALAVAIN
GSIWEQRVPIPGADGFVLHPVLAAGGDERLHAARVEKGELVIPGLSVVVFAKPQQGEQGA
GMDVGGEPLFLRGSFSKTPWDASTPMIYKGAGVYETSLTLAAGSHQLKVASGDWDPQFGA
GNLSAGFGSLPWRNVSGNVQIEALASGTYRFTLSLANPAQPRLTITAPDAPPLVPPPYGD
EALYLRGTLTDWQSGAALTYVGNGKYGASVYLQPGEYRFKIASEDWTRVRLQFGDLSAPE
GGLTLLDAGNDGQILIRVTGAGLYRFVLDASDLQSKTLSVTTDASPTPANGVMMQYFHWY
NTQEDNLWLKVADEASTLAAKGVTALWLPPASKAMIRPDGSLDVGYATYDLYDLGEFNQQ
GSVRTRYGDKEQYLAAIERAHRAGIQVYGDVVLNHKFGADQTETVTAVRVEGSNRNQEYG
GDGEISAWTRFDFPGRGDTYSDFKWRWYHFDGVDWDAGKQEKAIFKFRGLGKGWDGEVSG
EFGNYDYLMGADLDMDHPEVVEELKRWGRWYVNAASLDGFRLDAVKHIKASFFKAWLDGV
RGSTGKGLFTVGEYWDYDRAGLQGYLKATGYRMALFDAPLHLNFHNASRGNGDFDMGSLL
NGTLMQSNPAHAVTLVENHDTQPLQMLESPVLDWFKPLAYSFILLRQEGYPNLFYADYYG
ASYRDKGRDGQEHDIRIASQQGVIDTLLQVRRDHAYGTQRSYLNDRDVIGWTREGDSAHP
RGVAVLMTDNGYEGRKWMEMGPTHRNRCFQDVTGHYGERVCANGDGWAEFKTKPGAVSVW
VGEAP
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggacgccggcagtggcatctgggcgttcgatggcgccgccagcctggagggg
agcttctatcgctatgcgatagaggcttaccactacaagagcggcaagctggagcggatg
accaccacggatccctactcggtctccctgagtaccgccagccgtttctcgcagttggtg
aatttggacggggagcaggccaagccggtcggttgggatgcccagagtgtgccgcccctg
gccaagccggaagacagcatcatctacgagctgcatatccgcgacttcagtaattcggac
aaggagggaacggctgcgttcaacggcaaatatctcgccttcacggaaggggcgcgcgcc
agcgtgcagcacctcaagctgctgcgggaggccgggctcaacaccatccacctgttgccg
agcttcgatctctcctcggtggaggaggaggccgcccggcgcatggatctcgacgacgat
gtgagcaagctctgcgaccccgccaagggactcaaccccaaggcagccctctgcgccagg
gccggtagcggtaccctgcgcagcctgctggaggggctcgatcccgccagcggcgatgtc
caggcactgcttgcggagatccgcccgaaggatggcttcaactggggatacgatccctac
cactacaacgcccccgaggggagctatgcggtcgagagcgacggcctgccccggatccgc
gagtaccgcaccatggtgcaggccctgcaccagatgggctttagggtggtgcaggatgtg
gtcttcaaccacaccagctcctcgagcctctataacacctcagtgctcgacaaggtggta
cccggttactaccacaggcgtaacccggacaacggcctggtagagagctccacctgctgc
gacaacaccgcctccgagcatcgcatgttcgagaagctggtggccgacagcctggtctcc
tgggcaactgagtacaagatcgacggctttcgtttcgatctcatgggccacctgatgaag
tcgagcgtggtcaaggcgttcgatgcggtgaaacgggtcgatggcgacacctggttctac
ggggaggggtgggactttggcgaggtgcaaaacaatgcccgcggcgtcaactcgagccag
tggaacatggccggcaccggcatcggcacttataacgaccggctgcgcgatgcggtgcgt
ggcgatcactccgatcccatgaatggcacgccgggcttcgccaacgccggtgatcgcttc
gatgccatgggcaacaagatggatctcatccgcctcggcatggcggccaacctgcagacc
tatcccctgcccaccgatggcggcctggtgctgggccgtgactaccagtttggtggccac
ggggccggttatgcggcagatccccaggagacggtcaactatgtctctaaacacgacaac
cagaccctgtgggacatcaaccagtacaaggccaagggggaggtatcacccctggaccgg
gcccgcatgcagatagtggggctcgcccccgtgctgctgggccagggggtgcccttcctg
cacatgggctctgagctgctgcgctccaaatccatggagcgcgacagctacgactcgggc
gactggtttaaccgggtcgacttcagcaagcagggcaacaactggaacgtcggcttgccc
cgtcaggacaaggacggcagcaactgggagtggattggccggatcatcgccaaccccaac
acccgggtcggtccggccgagatcgcctggagcgacgcccgtttccgggagctgctcgct
atccgcgccggcagcgaactgctgcgcctcggcgagacggatcagatcctcaagcgggtg
cgcttccacgccatcggcagccaggcccgccccggcaccatcgtcatgacggcggatgac
ggggtggcggccggtgcggatctcgatcccgccaatcaggcgctggcggtcgccatcaac
ggcagcatctgggagcaacgggtccccattcccggtgccgatgggttcgtcctgcaccct
gtgctggcggccggtggcgacgagcggctgcacgccgcccgggtcgagaagggagagctg
gtgatcccggggctgagcgtcgtggtctttgccaaaccccagcagggtgagcagggggcc
ggcatggatgtgggcggcgagcccctcttcctgcgtggctcctttagcaagaccccctgg
gatgcctcgacccccatgatctacaagggggcgggcgtctatgagaccagcctcacgctg
gcggcgggttcccaccagctcaaggtggccagcggcgactgggatccccagttcggtgcc
ggcaacctgagcgccggtttcgggtctttgccgtggcgcaacgtgagtggcaatgtgcag
atcgaggcgctggcgagcggtacctaccgcttcacgctgagtcttgccaacccggcccaa
cccaggctcaccatcacagcccccgatgcgccgcctctggtgccgcccccctacggggat
gaggccctctacctgcgcggtaccctcaccgactggcagtcgggcgccgcactcacctat
gtgggcaacggtaaatacggcgccagcgtctacctgcagccgggggagtatcgcttcaag
atcgcctccgaagactggacccgggtccgcctccagttcggggatctgagtgcacccgag
ggggggctgaccctgctggacgctggcaacgatggccagatcctgatccgggtgaccggc
gccggcctctaccgcttcgtgctcgatgccagcgatctgcagagcaagacgctgtcggtg
accacggacgcgtcgccgacgccggccaacggggtcatgatgcagtacttccactggtac
aacacccaggaggataacctctggctcaaggtggcggatgaggcgtcgaccctggccgcc
aagggcgtcaccgcgctctggctgccgccggcgagcaaggcgatgatccgccccgacggc
tcactggatgtgggctacgccacctacgatctctacgatctgggggagttcaaccaacaa
gggtcggtgcgtacccgttacggggacaaggagcaatatctcgccgccatcgagcgcgcc
caccgggccgggatccaggtctatggggacgtggtgctcaaccacaagttcggcgccgat
cagaccgagaccgtcaccgccgtgcgagtggaggggagcaatcgcaaccaggagtacggc
ggcgacggcgagatcagcgcctggacccgtttcgacttcccgggccgtggcgacacctac
tccgacttcaagtggcgctggtaccacttcgacggggtggactgggatgccggcaagcag
gagaaggccatcttcaagttccgcggcctcggcaaggggtgggatggggaggtgagcggc
gagtttggcaactacgactacctgatgggggccgatctcgacatggatcaccccgaagtg
gtcgaggagctcaagcgctggggccgctggtatgtcaatgccgcctccctcgatggattc
cggctcgatgcggtcaagcacatcaaggcgagcttcttcaaggcgtggctcgacggggtg
cgcggcagcaccggcaaggggctcttcacggtcggcgagtattgggactacgacagggcc
ggactgcaggggtatctcaaggccaccggctatcgcatggccctgttcgatgcccccttg
cacctgaacttccacaacgcctcccgggggaacggcgacttcgacatgggcagcctgctc
aatggcaccctgatgcagtccaacccggcccatgcggtgaccctggtggagaaccacgac
acccagccgctgcagatgctcgagtcgccggtgctggactggttcaagccgctggcctac
tccttcatcctgctgcgccaggaggggtatcccaacctcttctacgccgactactacggc
gccagctaccgggacaaggggcgggacggtcaggagcacgacatccgcatcgcctcccag
cagggggtgatcgacaccctcttgcaggtgcgccgcgaccacgcctatggcacccagcgc
agctatctcaacgatcgggatgtgatcggctggacccgtgagggggacagtgcccacccg
aggggggtggccgtgctcatgaccgacaacggctatgaggggcgcaagtggatggagatg
gggcccactcatcgcaaccgctgcttccaggatgttaccggtcactatggtgagagggtc
tgtgccaacggcgacggttgggccgagttcaagaccaagccgggcgccgtctcggtctgg
gtgggggaggccccttaa

DBGET integrated database retrieval system