KEGG   Archaeoglobus sulfaticallidus: Asulf_01980Help
Entry
Asulf_01980       CDS       T02642                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
ast00630  Glyoxylate and dicarboxylate metabolism
ast01100  Metabolic pathways
ast01120  Microbial metabolism in diverse environments
ast01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ast00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Asulf_01980
Enzymes [BR:ast01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Asulf_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AGK61946
UniProt: N0BMV6
LinkDB All DBs
Position
1789647..1790891
Genome map
AA seq 414 aa AA seqDB search
MGFEWYTDFVDLSYKPEDEIVCYFKVKSDLPIEESSGRVASESSVGTWTTLSRLPDRIKW
LMAKVFRIDGERIAVAYKTDLFEEGNIPQFLSSVAGNIFGMRAIKGLRFEDFEVPASFAK
HFKGPNFGIDGVRNIMRVHDRPLTATVPKPKVGFDADEYAEVGYRSWVGGIDILKDDENL
TSQPFIRFEKRLAKVMKARERAENETGEKKGYLINITAEAREMERRAELVADYGNEFVMV
DILTAGFSAVQTVRNKCEELGLAIHAHRAMHGAFTRNEEHGISLKVLTKLARMAGVDHMH
VGTGVGKMAGDKAEVMELRDVCRKSWHNFKPVFPVSSGGLHPGLIPDIIELFGVDVIIQA
GGGVHGHPDGSEKGAMALRQAISAVLEGVDLEDYAKSHSELARALERWGRVSPK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgaatggtataccgattttgtggatctcagctacaagccggaagatgagata
gtgtgctattttaaggtaaaatccgatctgccaattgaggaatcatctggcagagttgct
tctgaaagctctgtggggacatggactactctttcgaggcttcctgacaggataaagtgg
ttgatggcaaaagtgttcagaattgatggggagagaattgctgtagcgtacaaaacagat
ctgttcgaggaaggtaacatccctcagtttctcagctcggttgcgggcaacatattcggg
atgagggcgataaaggggttgaggtttgaggattttgaggtgccagccagctttgcaaag
cactttaaaggacctaactttggaatcgatggtgttagaaatataatgagggtgcatgat
cgaccgctgacagccacagttccaaaaccgaaggttggtttcgatgccgatgagtatgct
gaagttggatacagatcctgggttggcggaatagacatcctgaaggatgatgagaatctg
accagccagccattcataaggttcgaaaagaggctggcgaaggttatgaaagccagagag
agagcggaaaatgaaactggagagaaaaagggatacctgataaacataactgctgaagcc
cgtgagatggaaagacgggctgaacttgtagcagattacggaaatgaattcgttatggta
gatatactgacagccggattctctgcagttcagactgtgagaaataagtgtgaagagctt
ggactggccatccatgcacacagagctatgcatggtgcgtttacgaggaatgaggagcat
ggaatctctctgaaggttctaacaaagctcgccagaatggctggagtggatcacatgcat
gtcggtaccggtgttggcaagatggcgggagacaaagcggaagtgatggaactcagagat
gtttgcaggaagagctggcacaacttcaagccggtctttccggtgtcttcaggtggtctg
catccggggctgattccggatataattgagctgttcggtgttgatgtgataatacaggct
ggtggaggagtccatgggcacccggacggcagtgagaagggagctatggctttaaggcaa
gcgatatctgcagtacttgaaggggtggatcttgaagattacgcgaaatcgcacagcgag
cttgcaagggcacttgagagatggggtagagtttcacccaagtag

DBGET integrated database retrieval system