KEGG   Alkalitalea saponilacus: CDL62_10240Help
Entry
CDL62_10240       CDS       T04906                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00500  Starch and sucrose metabolism
asx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDL62_10240
Enzymes [BR:asx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CDL62_10240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 DivIC
Motif
Other DBs
NCBI-ProteinID: ASB49491
UniProt: A0A1T5FTV4
LinkDB All DBs
Position
complement(2608044..2609381)
Genome map
AA seq 445 aa AA seqDB search
MKTICLYFQVHQPFRFRRYRFFDIGNDHYYFDDYSNESIMNKVANDCYIPTNDLLLKMLK
KHKGKFKVTFSISGLAIEQFKLYAPEVIDSFKKLSETGMVEFLNETYSHSLVSLTDEEAF
KSQVDAHANLMVELFGSKPAIFRNTELIYSDHIGEMVSKMGYKAMLTEGAKHILGWKSPN
FLYCNAANPRLKILLKNFKLSDDIAFRFGNRNWCEWPLTASKYISWIKDMEPREEIINLF
MDYETFGEHQHRSTGIFQFLENLPSEAFKHKGIGFATPSEIIESHQVVAPVSVPHPISWA
DEERDLTAWLGNEMQQEAFKKLYALLPKIQQCTDPKILKDWNYLQCSDHFYYMCTKFFSD
GDVHAYFNPYETPYEAFINYMNVLSDFSIRLNASVPESNMDQEISNLTDILYKKDETIKK
LEDEIKKLRKRRTSAKKTLTVKSKT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatctgtttatacttccaggttcaccaacctttcaggtttcgtagataccgc
ttttttgatataggtaacgaccattactattttgatgactactccaatgaaagcatcatg
aataaagtagcaaatgattgctacattccgaccaatgatctgctcttaaaaatgctaaaa
aagcataaagggaaattcaaagtaacattctcaatctcagggctggctattgaacaattt
aaactatatgcacctgaagttattgacagtttcaaaaagctatccgaaacgggcatggta
gagtttctcaacgaaacctattctcactctttggtctccctcacggatgaagaagctttt
aaatcgcaggtagatgcacatgcaaatcttatggtggaactattcggcagtaaacctgcg
atatttcgaaatacagaattaatatactctgaccacattggcgaaatggtttcaaagatg
ggatataaagccatgctaaccgaaggagcaaaacacatcctcggatggaaaagtcccaat
tttctttactgcaacgcagcaaatccgcgtcttaaaattcttcttaagaattttaagctc
agtgatgatattgccttcagatttgggaatcgcaactggtgcgaatggccactgacagcc
tcaaagtacataagttggataaaagacatggagcctcgtgaagagattattaacctgttt
atggattatgaaacatttggggaacatcaacatagatccaccggcatattccagtttctt
gaaaatttaccctctgaggcttttaaacataaaggcatcggtttcgcaacaccttctgaa
ataattgaatcacatcaggtggtggctcctgttagtgttcctcaccccatttcatgggct
gacgaagagagggatttaacggcctggctgggtaacgaaatgcaacaggaagcatttaag
aaactctatgcacttctacccaaaattcaacaatgtactgatccaaaaatccttaaggac
tggaactatttgcaatgcagcgaccatttttactatatgtgtaccaagtttttctccgat
ggagatgttcatgcatattttaatccttacgaaactccctacgaagcattcataaactat
atgaatgtattaagcgatttctccattcggctgaatgcgtctgttccggaatccaacatg
gatcaggaaatatccaatcttactgacatcctttacaaaaaggatgaaacaataaagaaa
cttgaggatgaaataaaaaaactcaggaaaagaagaacatcagcaaaaaaaacgctgaca
gtaaaatccaaaacctga

DBGET integrated database retrieval system