KEGG   Agrobacterium tumefaciens S33: AWN88_04490Help
Entry
AWN88_04490       CDS       T04213                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ata00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AWN88_04490
Enzymes [BR:ata01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AWN88_04490
DNA repair and recombination proteins [BR:ata03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AWN88_04490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
circular:1006343..1008994
Genome map
AA seq 883 aa AA seqDB search
MANDKLSTYRQKRDFQKTQEPSGKTKLKASNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLYPQDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGNRTPE
QALAKGDFKFTLEGERLHGSFVLVRMRNDREGGKRTNWLLIKHRDDFSVEENGDAILDEK
NTSVASGRTMAAIAAGKGKKPKPFMVQSGDVQADAVWDSNHGLAADKRAADTKKRRPAAR
TAAKSAMPDFIPPQLCETLDRPPSADGWIHEIKFDGYRIQARIENGEVTLKTRKGLDWTA
KYPAIATSAASLPDAIIDGEICALDENGAPDFAALQAALSEGKTDALVYFAFDLLCEGSE
DLRQLPLTERKKRLEALLSEAGEDPRLRFVEHFETGGDAVLKSACKLSLEGIVSKQADAP
YQSGRTDTWAKSKCRAGHEVVIGAYAKTNGKFRSLLVGVFRDDHFVYVGRVGTGYGAKTV
DTILPKLRELETSKSPFTGIGAPKKEPNIVWVKPELVAEIQFAGWTADGLVRQAAFKGLR
QDKPAKEVEAEKPASPGKTDTPTPAATKPSSPARGKNAKAEVMGVMISSPDKPLWPDAND
GEPVTKEDLAHFHEAVGLWLIDHIKGRPCSIIRTPDGIGGEQFFQRHAMPGTSNLLELVK
VFGDKKPYLQIDRVEGLAAIAQIGGVELHPWNCEPNEPEVPGRLVFDLDPGPDVPFSTVV
EAAREMRDRLEELGLVSFCKTTGGKGLHVVTPLAVPKGKKLSWPEAKGFAHDVCLQMARD
NPDLYLIKMSKNQRNGRIFLDYLRNDRMATAVAPLSPRARPGAPVSMPLTWKQVKADLDP
KRFTIRTVPALLSKTTAWEDYCDGQRSLEQAIKRLTKSMKQAA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgacaagctttcgacctacaggcagaaacgcgattttcagaagacgcaggag
ccaagcggaaaaacgaagctgaaagcttcaaaccgcaggcgctttgtcatccagaaacat
gacgccacgcggctccattatgacctgcgcctcgaactcgacggcgtcttcaagtcctgg
gctgtgaccaagggaccgtctctctatccccaggacaagcgcctggccgtggaggtggaa
gaccacccgctggactatggtgacttcgaaggcacgattcccaaaggccagtatggcggc
ggcacggtcatgctctgggaccgcggctactgggagccggaaggcaacaggacgcccgag
caggctctcgccaagggcgacttcaagtttacccttgaaggagagcggctgcatggcagc
ttcgtgctggtgcggatgcgcaacgaccgtgagggtggcaagcggacgaactggctgctg
atcaagcatcgcgacgacttctcggtcgaagaaaacggcgacgccatccttgacgaaaaa
aacacgtcggttgcctcgggcagaaccatggccgccatcgccgcaggtaaaggaaagaaa
ccaaaaccgttcatggtgcagagcggcgatgtgcaggccgacgctgtctgggacagcaat
cacggactggcggcagacaaacgtgcggcggatacgaagaaaaggcgcccggcagcgcgg
acagcagcgaagtccgcgatgcccgatttcatacctccgcagctttgcgaaacgctcgac
cgcccaccctcggccgatggctggatccacgagatcaaattcgacggataccgtattcag
gcgcgcattgaaaatggcgaagtcacgctgaagacgcgcaaggggctggactggacggcc
aagtatccggcgattgcgacatcggccgcaagcttgcctgatgccatcatcgacggtgag
atctgtgcactcgatgaaaacggtgccccagacttcgccgcacttcaggcggcgctgtca
gaaggtaaaacggatgcgctcgtctattttgcttttgacctgctgtgcgaggggagtgag
gatctaaggcaactgccgcttacggaacgcaagaaaaggctcgaagcgcttctgagcgag
gcgggggaagatccgcgcctgcggttcgtcgaacactttgagaccggcggcgatgcagta
ttgaaatcggcctgcaagctctcgctggagggcattgtctcgaagcaggcggatgccccc
tatcagtcggggcgcaccgatacctgggcgaaatccaaatgccgcgccggacatgaggtt
gtcattggcgcttacgcgaaaaccaacggcaagtttcgttcacttcttgtcggcgtcttc
agggacgatcacttcgtctatgtcgggcgggtcgggaccggctatggtgccaaaacggtg
gatacaatcctgccgaagctccgggaactggaaacctcaaagtcgccctttaccggaata
ggcgctccgaaaaaggaacccaacatcgtctgggtcaagcccgaactggtggccgagatc
cagttcgccggctggaccgcggacggacttgtccgtcaggcagccttcaagggtttgcgc
caagacaagccggcgaaggaggtcgaggccgaaaagccggcatcgccgggaaagaccgat
accccgacgccggccgcgacaaagccatcgagtcccgcgcgcggcaagaacgccaaggcc
gaggtgatgggcgtgatgatctccagccctgacaagccgctctggcccgatgcaaatgac
ggtgagccggtcaccaaggaggatctcgcgcactttcatgaggccgttggtctatggctg
atcgaccatatcaagggacggccatgctccatcatccggacgcctgacggcatcggtggt
gagcagttcttccagagacacgcgatgccgggaacgtcgaacctgctcgagctggtcaag
gtgttcggcgacaagaaaccctatctgcagattgatcgcgttgagggccttgccgccatc
gcccagatcggcggcgtcgaactgcatccctggaattgcgagcccaacgaaccggaggtg
cccggtcgtcttgtcttcgaccttgatccgggtccggacgtacccttctccaccgtggtc
gaagccgcccgggaaatgcgcgaccggctggaggaacttggcctcgtcagcttctgcaag
accaccggcggcaagggccttcacgtcgtcaccccgcttgcggtaccgaagggaaagaag
ctgagctggccggaggcgaaaggcttcgcacacgatgtctgcctgcagatggcacgtgac
aaccctgacctttacctgatcaagatgtcgaagaaccagcgcaacggccggatcttcctc
gactacctgcgcaatgaccgaatggcgactgctgttgcgccgctgtcaccgcgcgcccgg
ccaggcgcgccagtatcgatgccactgacctggaagcaggtaaaagcggatctcgatccg
aaacgcttcaccattcgcaccgtaccggcgcttttgtcgaagacaaccgcctgggaggat
tactgcgacgggcagcgttcgctggagcaggccatcaagcggctgacgaagtcaatgaaa
caggccgcctga

DBGET integrated database retrieval system