KEGG   Agrobacterium tumefaciens S33: AWN88_13690Help
Entry
AWN88_13690       CDS       T04213                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00340  Histidine metabolism
ata01100  Metabolic pathways
ata01110  Biosynthesis of secondary metabolites
ata01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ata00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    AWN88_13690
Enzymes [BR:ata01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     AWN88_13690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: AMD59325
UniProt: A0A120KH11
LinkDB All DBs
Position
linear:517741..518193
Genome map
AA seq 150 aa AA seqDB search
MSIPFPSAPADKEALENAGLFSPKFDAHGLVTAVVTDARDGELLMVAHMNAQALSLTLET
GIAHYYSRSRDKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSCFY
RTVELADGQAVTKITDDTRHFDPATTYSGT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtccattccctttccgtccgcgcccgcggacaaggaagcgcttgaaaacgcaggtctc
ttttcgccgaaattcgacgcccatggcctcgtcacagctgtagtcaccgacgcgcgcgat
ggcgaactgctgatggtcgcccatatgaacgcacaggccctgtcgctgacgcttgagacc
ggcatcgcccactattacagccgttcgcgcgacaagatctggaagaagggcgaaacgtcg
ggcaacctgcagaccgtgaaggaattccgcaccgattgcgatcaggacgccgtgtggctg
aaggtctcggtcgccggccacgatgctacctgccacaccggccgccgctcctgcttctac
cgcacggtcgaactggctgatggccaggcggtgacgaaaatcaccgacgatacgcgccat
ttcgatccggcgacgacctattcaggcacataa

DBGET integrated database retrieval system