KEGG   Arabidopsis thaliana (thale cress): AT1G08830Help
Entry
AT1G08830         CDS       T00041                                 

Gene name
CSD1
Definition
(RefSeq) copper/zinc superoxide dismutase 1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AT1G08830 (CSD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT1G08830 (CSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 152 aa AA seqDB search
MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA
DPDDLGKGGHELSLATGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaggagttgcagttttgaacagcagtgagggtgttacggggactatctttttc
acccaggaaggcgatggtgtgaccactgtgagtggaacagtttctggccttaagcctggt
cttcatggtttccatgtccatgctcttggtgacaccactaacggttgcatgtctactggt
ccacatttcaaccccgatggtaaaacacacggtgcccctgaggatgctaatcgacatgct
ggtgatctaggaaacatcactgttggagatgatggaactgccaccttcacaatcactgat
tgccagattcctcttactggaccaaactctattgttggtagggctgttgttgtccatgca
gaccctgatgacctcggaaagggaggccatgaactcagcctggctactggaaacgcaggc
ggccgtgttgcttgcggcatcattggtctccagggctaa

DBGET integrated database retrieval system