KEGG   Arabidopsis thaliana (thale cress): AT5G17330Help
Entry
AT5G17330         CDS       T00041                                 

Gene name
GAD
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AT5G17330 (GAD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT5G17330 (GAD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G17330 (GAD)
   00430 Taurine and hypotaurine metabolism
    AT5G17330 (GAD)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT5G17330 (GAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5
AA seq 502 aa AA seqDB search
MVLSHAVSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEK
TERFNIVSKDEGVPLVAFSLKDSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITVLRVV
IREDFSRTLAERLVIDIEKVMRELDELPSRVIHKISLGQEKSESNSDNLMVTVKKSDIDK
QRDIITGWKKFVADRKKTSGIC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccacgccgtatcggagtcggacgtctccgtccactccacattcgcatca
cgttacgtccgtacttcacttcctaggttcaagatgccggaaaactcgattcctaaggaa
gcggcgtatcagatcatcaacgacgagctgatgcttgacgggaatccacggttgaactta
gcctcctttgtgacgacatggatggagcctgagtgtgataaactcatcatgtcctccatc
aacaagaactatgttgacatggacgagtaccccgtcaccaccgaacttcagaaccgatgt
gtgaacatgattgcacatctattcaatgcaccgttagaagaggcggagaccgccgtcgga
gtaggaaccgttggatcatcggaggccataatgttggccggtttggccttcaagcgtaaa
tggcagaacaagcgcaaagctgaaggcaaacccgtcgataaacccaacattgtcaccgga
gccaatgttcaagtgtgttgggagaaattcgctaggtactttgaggttgaacttaaggaa
gtgaaattgagtgaaggatactatgtgatggaccctcaacaagctgttgatatggttgat
gagaacaccatttgtgttgcggccattcttggttccactcttaatggagaattcgaagat
gttaaactcttgaacgatctcttggtcgaaaagaacaaagaaaccggatgggatacacca
atccacgtggatgcggcaagtggaggattcattgcaccgtttttgtatccggaattggaa
tgggactttagacttcccttggtgaagagtatcaatgtgagtggtcacaagtatggactt
gtgtacgcagggattggttgggtgatctggagaaacaaagaggatttgcctgaggaactc
atcttccatatcaattatcttggtgctgaccaacccacctttactctcaatttctccaaa
ggttcaagtcaagtcattgctcaatactaccaacttatccgattgggccacgagggttac
agaaatgtgatggagaattgcagagagaatatgatcgtcctaagggaaggacttgagaag
acagaaaggttcaacatcgtctcaaaggacgagggagtgccacttgtcgctttctccttg
aaagatagcagctgtcacactgagttcgaaatctccgacatgcttcgcaggtatggatgg
atagtgccggcctacacaatgcctccaaatgcacaacacatcactgttcttcgtgtggtt
atcagagaagatttctcgagaacactcgctgagagacttgtgatcgatatagagaaagtg
atgcgtgagctcgatgagcttccttcgagagtgattcacaaaatatcacttggacaagag
aagagtgaatctaacagcgataacttgatggtcacggtgaagaagagcgatatcgacaag
cagagagatatcatcactggctggaagaagtttgtcgccgacaggaagaagacgagtggt
atctgctaa

DBGET integrated database retrieval system