KEGG   Azospirillum thiophilum: AL072_22315Help
Entry
AL072_22315       CDS       T04091                                 

Definition
(GenBank) hypothetical protein
Organism
ati  Azospirillum thiophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding Methyltransf_12 Methyltransf_11 Methyltransf_25 Methyltransf_23 AMP-binding_C NodS MTS
Motif
Other DBs
NCBI-ProteinID: ALG73695
UniProt: A0A0F2KTX7
LinkDB All DBs
Position
3:711448..718131
Genome map
AA seq 2227 aa AA seqDB search
MDNRSDAASLSSARPARIPAETLVGTLLGRAAETPDGIALRFIAEGTDDPLSYAELDRRA
RAIAVRLRGRAGPGDRAVLLLPSGPDYVAAFFGCLYAGVIAVPAYPPESVRPQHLARLQG
ILADAQPRFILTDSVLHGMLLEACRAMAGGGTPELLAVDGVDGGLAGDWSMPPLSGEDIA
FLQYTSGSTSAPKGVRVSHGTLIANERLIHHGFGIGPDDCIVSWLPLFHDMGLIGGLLQP
IHTGIPCVLMSPRYFLERPRRWLEAIGRYGGTISGGPDFAFRLCCERIADGALEGLDLRS
WRLAFSGSEPIRPDTLARFAERFAPAGFDRRSYFACYGLAEATLFVTGGRRGEGITLAPF
DGPALAANRAVPAAAGAAATVLAGCGHVQPDHPVRLVDPASGAEVGEGTVGEIWAGGPSI
ADGYWSNAEATARSFVERDGIVWLRTGDLGFLKDGELFVTGRLKDMLIVRGQNIYPQDLE
RSVEEEVEVVRKGRVAAFAVEQDGREGIGIAAEIGRTVLKLVTPEALCGAIAAAVADACQ
EAPALVALLEPGALPKTSSGKLQRSACRSLLDAGELPAFHVQRRGAAASAADTAPRPLTG
RECEVATVWAEVLGTAVTDAGAHFFALGGNSVSVVQVVARLRERCGLAADVADLFRHPTL
AEFAGRLSNAVPAMLRAASPQTGGTERIAEPSAAQARMWFNWKLDPRDCGYTISGRVQLR
GPLRRDLVQAAVDVLVGRHESLRTVFREEAGRPVQLVRPAGTLPVAVRLADLSGDGDREA
ALRRLLEEEVRAPFDLVDGPLMRVQLIACDADDHHLQVTLHHAIADGWSMNVLLDEFGEA
YAAGCEGRAPELPALAVQYADVARWQRDLLEAGEGARQLAYWAGRLGDRQPVLDLPADRP
RSAGGSQRGAAVHCAIDDGLATGLRALARRMGVTLPTLLLASYAALLHRYSGQDDIRVGC
TLANRRSVDSERLIGFFVNMVVLCADLSDDPAFDALLRRIGEAALDAQANQDLPFDRLVE
ELQPQRDLAHHPLFQAAYDHQWQRLDGLDRLPGLRVESVEHLQLATQFDLILHTTERAGP
DGTGRLGAFFTYSLDLFEPESVERMARHWLTLLRGIVADPALPVTCLPLMDAAETAALVA
GWNAPVRNIARRPAPLPADAPGLHARIAAQAHRHPDAPAVTCDGLTLSYGELDRRSDRLA
RQLRGLGVGPDRLVGLAAERSFDLIVGMLGILKAGGAYLPLDPSYPADRLLYMQADSGIG
LVVTQAHLRGKLPLADGVQAICVGEEPDAPDGPPPDGPPPDLGRAGSLAYCIYTSGSTGQ
PKGVAVTHANVLRLFDACPPDMRFDRHDVWALFHSYAFDFSVWEIFGALLHGGRLLVVPY
YTSRSPADCFALLRDEGVTVLNQTPSAFRQLVPVALGSPRDSLSLRLVVFGGEALEMESL
RGWFEHFGDSRPLLVNMYGITETTVHVTHRLLAMADLPKPGEVTDQPEAGAPVGMPLGDL
RWYFLDRHLQPVPPGVAGEIHVGGAGLARAYLNRPGLTAGRFVADPFGGSFGDPGGRLYR
SGDLARFRPDGRVEYLGRADQQIKLRGFRIEPGEIEAAIRRQPAVADAAVLLRGDAADRR
LVAYAVADEAALRDRPEEVSGELVGQWNTVFDGTYSRADAAAGPGFTGWNDSYDDRPIPE
AQMREWLDATVARILALAPERLLEIGCGVGLLTQAVAPHCAVYHGTDFSAQAIADLGAWA
AGRPELAHVRLSRREATDFAGVEEGGYDTVVINSVAQYFPDGDYLLRVLEGAVRALRPGG
RIFLGDLRPLHLQPLFHASVALWRAEAQASPAQLRARVVRATAEDGELLLAPGFFAALRG
RIPGIGRIDIDLRRGRADNELTRYRFDAVLHIGAEEVAPAGGWREAGEDLPRLDRLLAEE
RPAGLRIAGIANRRLARDLAAWTAMSAASSPAADALRERIDRLDPAGADPDAYRALAEAH
GYRARIGWSVGPDGAGDADGRFDVEIFDPARLERSPAVSEPATAGGWRAQCSDPLLARQR
RSFAPHLLSALRGSLPAHMVPSQLLRVDRLPLTVNGKLDRDRLADHDQPMQVTAAAHVPP
ESPVEQALAAIWAEVLGLTRVGLDDDFFELGGHSLLATQVASRIAADLGVTLDIRALFEA
PVLRSLARRVEERRAAAQPAAASAIEDELTAALKAIEGLSEVELNALADAALTGGANTDS
ANTGTAR
NT seq 6684 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccgttcagacgccgcctccctttcgtcggcccggcctgcgcgcatccccgcc
gagacgctggtcggcacgttgctcggacgggccgcggagacgcccgacggcatcgccctg
cgcttcatcgccgaggggacggacgacccgctcagctatgcggagctggatcggcgggcg
cgcgccatcgccgtccgcctgcgcgggcgggccgggccgggcgaccgcgccgtcctgctg
ctgccgagcggtcccgattatgtcgccgccttcttcggttgcctctatgccggcgtcatc
gccgtgccggcctatccgccggaatcggtccggccgcagcatctggcccggctccagggc
atccttgccgatgcgcagccgcgcttcatcctgacggattcggtcctgcacggcatgctg
ctggaggcatgccgggccatggcgggcggcggaacgccggagctgctggcggtggacgga
gtggatggcgggcttgccggcgactggtcgatgccgccgctgtcaggcgaggacatcgcc
ttcctgcaatacacctccggctccacctcggcgcccaagggggtgcgggtcagccacggc
accctgatcgccaacgagcggctgatccatcacggcttcggcatcggccccgacgactgc
atcgtcagctggctgccgttgttccatgacatgggcctgatcggcggcctgctgcagccg
atccacaccggcattccctgcgtgctgatgtcgccgcgctatttcctggagcggccgcgg
cgctggctggaggccatcggccgctatggcggcaccatcagcggcgggcccgacttcgcc
ttccgcctgtgctgcgagcgcatcgccgacggcgcgctggaggggctggatctgcggtcc
tggcgccttgccttctccggctccgagccgatccgtcccgacacgctggcccgcttcgcc
gagcgcttcgccccggcggggttcgatcgccggtcctatttcgcctgctacgggctggcc
gaggcgacgctgttcgtcaccggcggccggcgcggggagggcatcaccctggcgccgttc
gacgggccggcgctggcggcgaaccgggcggtgccggcggcggccggcgcggcggcgacg
gtgctggccggctgcggccatgtgcagcccgatcatcccgtgcggctggtcgatccggcc
agcggcgcggaggtcggagagggaacggtcggcgagatctgggccggcggacccagcatc
gccgacggctattggagcaatgcggaggcgacggcccgcagcttcgtcgagcgtgacggc
atcgtctggctgcgcaccggcgacctgggatttctgaaggacggcgagctgttcgtcacc
ggccggctcaaggacatgctgatcgtgcgcggccagaacatctatccgcaggatctggag
cgcagcgtcgaggaagaggtcgaggtcgtccgcaaggggcgggtcgccgccttcgccgtc
gagcaggatggccgcgaggggatcggcatcgccgccgagatcggcaggacggtgctgaag
ctggtgacgccggaggcgctgtgcggcgccatcgccgccgcggtggccgacgcctgccag
gaggcgccggcgctggtcgccctgctggagccgggcgccctgcccaagacctccagcggc
aagctgcaacgctccgcctgccggtccctgctcgacgcgggcgaactgccggcctttcat
gtccagcgccggggagcggcggcttcggccgcggacaccgctccccgtcccctgacgggg
cgggaatgcgaggtcgccacggtctgggcggaggtgctgggaaccgccgtcaccgatgcc
ggggcccatttcttcgcgttgggcggcaattccgtgtcggtggtgcaggtggtcgcccgg
ctgcgcgagcgctgcggactggcggccgacgtcgccgacctgttccgccatccgacgttg
gcggagtttgccggccggctgtccaacgccgtccccgccatgctccgggcggcgtcgccg
cagacaggcgggacggagcgcatcgccgaaccgtcggcggcccaggcccgcatgtggttc
aactggaagctcgacccgcgggactgcggctacaccatttccgggcgggtccaactgcgc
gggccgctgcgacgcgatctcgtccaggcggcggtcgacgtgctggtcggtcgccacgag
agcctgcgcaccgtcttccgcgaggaggccggccggccggttcagcttgtgcggcccgcc
ggaacgctgccggtcgccgtccgtctcgccgatctgtccggcgacggggaccgcgaagcc
gcgctgcgccgcctgctggaggaggaggtccgcgcgcccttcgatctggtggacggcccg
ctgatgcgggtgcagctgatcgcctgcgacgccgacgaccatcatctgcaggtcaccctg
catcacgccatcgccgacggctggtcgatgaacgtcctgctcgacgagttcggcgaggcc
tatgccgccggctgcgagggcagggcgcccgagctgccggcactggccgtccagtatgcc
gacgtcgcccgctggcagcgcgacctgctggaggcgggggagggggcacgccagctcgcc
tattgggccggccggctgggcgaccgacagccggtgctggacctgccggccgaccgtccg
cgctccgccggcggcagccagcgcggggcggcggtccattgcgccatcgacgacgggctc
gccaccggcctgcgtgcgctggcgcggcggatgggggtgacgctgccgaccctgctgctc
gccagctacgcggcattactgcaccgctattccggccaggacgacatccgcgtcggctgc
acgctggccaaccggcgcagcgtggacagcgaaaggctgatcggcttcttcgtcaacatg
gtggtgctgtgcgccgacctgtcggacgatcccgccttcgacgcgctgctccgccggatc
ggcgaggcggcgctcgacgcccaggccaaccaggatctgcccttcgaccggctggtggag
gagttgcagccccagcgcgaccttgcccaccatccgctgttccaggccgcctacgaccac
cagtggcagcggctggacggtctcgaccggctgccgggcctgcgggtggagtccgtcgag
catctgcagctcgccacccagttcgacctgatcctgcacaccaccgagcgggccggaccg
gacgggaccggccggctcggcgccttcttcacctacagcctcgacctgttcgagccggaa
agcgtggagcggatggcgcggcactggctgaccctgctgcgcggcatcgtcgccgacccg
gcgctgccggtcacctgcctgccgctgatggatgcggcggagacggcggcgctggtcgcc
ggctggaacgcccccgtccgcaacatcgcccgccgtccggcaccgcttccggccgacgcc
cccggcctacatgcccgcatcgcggcccaagcgcaccggcatcccgatgccccggccgtg
acctgcgatggcctgaccctgagctatggcgagctcgaccgccgcagcgaccggctggcg
cggcagctgcgcgggctcggcgtcgggccggaccggctggtcgggctggcggcggagcgc
tccttcgacctgatcgtcggcatgctcggcatcctgaaggcgggcggcgcctatctgccg
ctcgacccctcctatcccgccgaccggctgctctacatgcaggccgacagcggcatcggg
ctggtcgtcacccaggcccatctgcgcggcaagctgccgctggccgatggtgtgcaggcg
atctgcgtcggcgaggagcccgacgcgccggacggaccgccgccggatggaccgccaccg
gacctgggccgggccggatcgctcgcctactgcatctacacgtcggggtccaccggccag
ccgaagggcgtggctgtcacccatgccaatgtgctgcggctgttcgatgcctgcccgccc
gacatgcgcttcgaccggcacgacgtctgggcgctgttccattcctatgccttcgacttc
tcggtctgggaaatcttcggcgccctgctgcatggcgggcggctgctggtggtgccctac
tacaccagccggtcgccggccgactgcttcgccctgctgcgggacgagggagtgacggtg
ctgaaccagacgccgtccgccttccggcagctggtgccggtggctctgggctcgccgcgc
gactccctgtcactccggctggtggtgttcggtggcgaagcgctggagatggagagcctg
cgcggctggttcgagcatttcggcgacagccgtccgctgctggtcaacatgtacggcatc
accgagaccaccgtccatgtcacccatcgcctgcttgccatggccgacctgccgaagccc
ggcgaggtaaccgaccagccggaagccggtgccccggtcggcatgccgctcggcgacctg
cgctggtacttcctcgaccggcatctccagccggtgccgcccggcgtggcgggtgagatc
catgtcggcggagccgggctggcgcgggcctatctgaaccgtcccggcctgaccgcaggg
cgtttcgtcgccgatcccttcggcggttcctttggcgatccgggtgggcgcctctaccgc
agcggcgatctcgcgcgctttcggcccgatggccgggtcgagtatctcggccgggccgac
cagcagatcaagctgcgcggtttccgcatcgagccgggcgagatcgaggcggcgatccgc
cgccagcccgccgtcgccgacgccgccgtgctgctgcgcggcgatgcggccgaccgccgt
ctcgtcgcctatgccgtcgccgacgaggcggccctgcgcgaccggccggaggaggtgagc
ggcgagctggtcgggcagtggaacacggtgttcgacggcacctattcgcgcgcggacgct
gcggcaggaccgggcttcaccggctggaacgacagctacgacgaccggccgatccccgag
gcgcagatgcgggaatggctggatgccacagtcgcgcgcatcctggccttggcccccgaa
cggctgttggagatcggctgcggcgtcggtctgctgacccaggcggtggcgccgcactgc
gccgtctatcatggaaccgacttctcggcacaggccatcgccgatcttggcgcctgggcg
gccgggaggccggaactggcccatgtccggctcagccggcgcgaggccaccgatttcgcc
ggggtggaggaaggcggctacgacaccgtcgtcatcaactccgtcgcccagtattttcct
gacggcgactatctgctgcgcgtgctggagggagcggtccgggccttgcggccgggcggg
cgcatcttcctgggtgatctgcggccgctgcatctccagccgctgttccatgcgtcggtg
gcgctctggcgggcggaggcgcaggcgagccccgcccagctgcgcgcccgcgtggtccgc
gccacggccgaggacggcgaactgctgctcgcccccggcttctttgccgccctgcgcggc
cggattccggggatcggccgcatcgacatcgacctgcgccgcggccgggccgacaacgag
ctgacccgctaccgcttcgacgccgtcctgcacatcggtgcggaggaggtggcgccggcc
ggcggctggcgcgaggccggggaagacctgccccgcctcgaccgcctgctggcggaggag
cggcccgccggcctgcggatcgccgggatcgccaaccgccggctcgcccgcgacctcgcc
gcctggacggcgatgtccgccgcatcctcgcccgcggcagacgcattgcgggagcggatc
gaccggctggaccccgccggcgccgatcccgacgcctaccgggcgctcgccgaggcgcat
ggctaccgcgcccgcatcggctggagcgtcggtccggacggtgccggcgatgcggacggc
cgcttcgacgtggagatcttcgatccggcgcggctggagcgttccccggcggtgtccgaa
ccggcgactgccggcggctggcgcgcgcagtgcagcgaccctctgctcgcccggcagcgg
cggtccttcgcgccgcacctgctgtccgccctgcgcggcagcctgccggcgcatatggtg
ccctcccagctgttgcgcgtcgaccggctgccgctgaccgtcaacggcaagctggaccgc
gaccggctggccgaccatgaccagcccatgcaggtgaccgccgccgcccatgtcccgccg
gaaagcccggtggagcaggcgctggccgccatctgggcggaggtgcttggcctcacccgt
gtcggcctggacgacgacttcttcgaattggggggccattcgctgctggcgacccaggtg
gcctcgcgcatcgcggccgatctgggggtgacgctggacatccgcgccctgttcgaggcg
cccgtcctgcggagccttgcccgccgggtggaggagcggcgtgccgccgcccagccggcc
gccgcatccgccatcgaagacgagctgaccgccgcgctgaaggccatcgaaggcctgtcg
gaggtcgaactgaacgcgctcgcggatgccgccctgaccggcggcgccaatacagacagt
gccaatacggggaccgcccgatga

DBGET integrated database retrieval system