KEGG   Azospirillum thiophilum: AL072_28965Help
Entry
AL072_28965       CDS       T04091                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ati  Azospirillum thiophilum
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ati00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL072_28965
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AL072_28965
   00680 Methane metabolism
    AL072_28965
Enzymes [BR:ati01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL072_28965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6:141908..144679
Genome map
AA seq 923 aa AA seqDB search
MSAILLQESPETKDQPLREDIRLLGRILGDTVRSQEGEAVFDIVERIRQTSIRFHREEDQ
GARKELEAILNSLSPPQTARVVRAYSFFSHLANIAEDQHHIRRTRAHALAGSSPRDGTMA
HALDEAIKAGVTTQQLKEFFDGALVSPVLTAHPTEVQRKSILTVQMAVAKLLAERDHGPM
TPEEEDTNLESLQRAVLTLWQTAILRATKLAVTDEVANGLTFYDYTFLREMPRFYAQLED
HLRKTDPSWATTELPSFLRMGSWIGGDRDGNPFVTAPVLRQAMRMQSTRALRFYLDELHT
LGAELSLSTRVIDVSEPLRQLAERSPDPSPHRKMEPYRRAISGIYARLAATMRTLDGLDA
PLHAVGDAPPYATPAEFRADLEIIDRSLTVNGSAALAKGRLRHLRRAVDLFGFHLASIDL
RQNSDVHERSVAELLSFADAGVDYAALSEDERIELLVRELETNRPLASRYAGYSEETSSE
LDILRTAADCRARFGTDALVNCVISKTDGVSDILEVAVLLKEAGLLRPKDKALDLNIAPL
FETIGDLRNCAATMDRLLSIPTYRSFLESRGNLQEVMLGYSDSNKDGGFMTSGWELYKAE
IALVEVFAKHGVRLRLFHGRGGSVGRGGGPSYQAILAQPAGAVQGAIRITEQGEVIAGKY
SNPEVGRRNLETLAAATLEATLLHPESAEPCTELFLQAMEELSESAFKAYRGLVYETDGF
EKYFWESTVIGEIANLNIGSRPASRKKSTSIEDLRAIPWVFSWAQCRLMLPGWYGFGSAV
KAYLAQHPDGMERLRAMHRDWGFFRTLLSNMDMVLAKSNIAIASRYAGLVSDPALRDAIF
SRIRTEWQDSIEVLLAITEQSALLEKNPLLARSIRNRFPYLDPLNHVQVELLKRHRSSDS
GEQIARGIHLTINGIAAGLRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcctgcttcaggaaagtcccgagacgaaggaccagccgctccgcgaagac
atccgcctgctcgggcgcatcctgggcgacaccgtgcgcagccaggaaggggaggcggtg
ttcgacatcgtcgagcggatccgccagacctccatccgcttccaccgcgaggaggaccag
ggtgcccgcaaggagctggaagcgatcctgaacagcctgtcgccgccgcagacggcgcgg
gtcgtccgggcctacagcttcttctcccacctcgccaacatcgccgaggaccagcaccac
atccgccgcacccgcgcccatgcgctcgccggctcgtcgccgcgcgacggcaccatggcc
catgcgctggacgaggcgatcaaggccggcgtcaccacccagcagctgaaggagttcttc
gacggcgcgctggtcagcccggtgctgaccgcccacccgaccgaggtgcagcgcaagagc
atcctgaccgtgcagatggcggtggccaagctgctggccgagcgcgaccacggcccgatg
acgccggaggaggaggacaccaacctcgaatcgctccagcgcgccgtcctgacgctgtgg
cagaccgcgatcctgcgcgccaccaagctggcggtgacggacgaggtggcgaacggcctg
accttctacgactacaccttcctgcgcgagatgccgcgcttctacgcccagctggaagac
catctgcgcaagaccgacccgtcctgggcgacgaccgagctgccgtccttcctgcggatg
ggcagctggatcggcggcgaccgcgacggcaaccccttcgtcaccgcacccgtcctgcgc
caggcgatgcggatgcagagcacccgcgccctgcgcttctacctggacgagctgcacacg
ctgggcgccgagctgtcgctcagcacccgcgtcatcgacgtgtcggagccgctgcgccag
ctggccgagcggtcgcccgacccgtcgccgcaccgcaagatggagccgtaccgccgcgcc
atctccggcatctacgcccggctggccgcgaccatgcgcaccctcgacgggctggacgcg
ccgctgcacgcggtgggcgacgcgccgccctacgcgaccccggccgagttccgcgccgac
ctggagatcatcgaccgctcgctgaccgtcaacggctcggcggcgctcgccaagggccgg
ctgcgccacctgcgccgcgccgtcgacctgttcggcttccatctcgccagcatcgacctg
cgccagaactccgacgtgcatgagcgctcggtggcggagctgctgtccttcgccgatgcc
ggcgtcgactatgcggcgctgtcggaggacgagcggatcgagctgctggtccgcgagctg
gagaccaaccgaccgctggcatcgcgctatgccggttattcggaggaaaccagctcggag
ctggacatcctgcgcaccgccgccgactgccgcgcccgcttcggcaccgacgcgctggtg
aattgcgtcatctccaagaccgacggcgtgtcggacatcctggaggtcgccgtcctgctg
aaggaggccgggctgctgcggccgaaggacaaggcgctggatctcaacatcgcgccgctg
ttcgagaccatcggcgacctgcgcaactgcgccgccaccatggaccggctgctgtcgatc
ccgacctaccgcagcttcctggaaagccgcggcaacctgcaggaggtgatgctcggctat
tcggacagcaacaaggacggcgggttcatgacctccggctgggagctgtacaaggccgag
atcgcgctggtcgaggtgttcgccaagcatggcgtgcggctgcggctgttccatggccgc
ggcggctcggtcggccgcggcggcggccccagctatcaggcgatcctggcccagccggcc
ggcgcggtgcaaggcgccatccgcatcaccgaacagggcgaggtcatcgccggcaaatat
tccaaccccgaggtcggccgccgcaacctggaaacgctggccgcggccaccctggaagcg
acgctgctgcatccggaatcggccgagccttgcaccgagctgttcctccaggccatggaa
gagctgtcggagagcgccttcaaggcctatcgcggactggtctacgaaaccgacggtttc
gagaagtatttctgggaatcgacggtgatcggcgagatcgccaacctcaacatcggcagc
cgcccggcctcgcgcaagaaatcgaccagcatcgaggatctgcgcgcgattccctgggtg
ttcagctgggcgcaatgccgcctgatgctgccgggctggtatggcttcgggtcggcggtg
aaggcctatctcgcccagcatccggacgggatggagcggctgcgcgccatgcaccgcgac
tggggcttcttccgcacgctgctgtccaacatggacatggtgctggcgaagtcgaacatc
gccatcgcgtcccgctatgccggcctggtatccgatccggcgctgcgcgacgccatcttc
tcgcgcatccgcacggaatggcaggacagcatcgaagtcctgctggcgatcaccgaacag
tcggcgctgctcgagaagaacccgctgctggcgcggtcgatccgcaaccgcttcccctat
ctggacccgctcaaccacgtccaggtggagttgctgaagcgccaccgctccagcgacagc
ggcgagcagatcgcccgcggcatccatctgaccatcaacggcatcgctgccggattgcgc
aacagcggctga

DBGET integrated database retrieval system